Oncostatin-M (OSM) Recombinant Protein | OSM recombinant protein

Recombinant Human Oncostatin-M (OSM)

Cat. Num. AAA962751

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Oncostatin-M (OSM); Recombinant Human Oncostatin-M (OSM); OSM recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-220, Full length protein
• Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR
• Sequence Length: 195

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for OSM recombinant protein

Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells.

NCBI and Uniprot Product Information

• NCBI GI #: 982742417
• NCBI GeneID: 5008
• NCBI Accession #: NP_001306037.1
• NCBI GenBank Nucleotide #: NM_001319108.1
• UniProt Accession #: P13725; Q6FHP8; Q9UCP6
• Molecular Weight: 28,484 Da
• NCBI Official Full Name: oncostatin-M isoform 2
• NCBI Official Synonym Full Names: oncostatin M
• NCBI Official Symbol: OSM
• NCBI Protein Information: oncostatin-M
• UniProt Protein Name: Oncostatin-M
• Protein Family: Oncostatin
• UniProt Gene Name: OSM
• UniProt Synonym Gene Names: OSM

NCBI Description

This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration ().