Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Glioma pathogenesis-related protein 1 Recombinant Protein | GLIPR1 recombinant protein

Recombinant Human Glioma pathogenesis-related protein 1

Gene Names
GLIPR1; GLIPR; RTVP1; CRISP7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glioma pathogenesis-related protein 1; Recombinant Human Glioma pathogenesis-related protein 1; Protein RTVP-1; GLIPR1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-232aa; Partial
Sequence
ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR
Sequence Length
266
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for GLIPR1 recombinant protein
References
The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors.Murphy E.V., Zhang Y., Zhu W., Biggs J.Gene 159:131-135(1995) Murphy E.V.RTVP-1, a novel human gene with sequence similarity to genes of diverse species, is expressed in tumor cell lines of glial but not neuronal origin.Rich T., Chen P., Furman F., Huynh N., Israel M.A.Gene 180:125-130(1996) Cloning and characterization of human RTVP-1b, a novel splice variant of RTVP-1 in glioma cells.Xiang C., Sarid R., Cazacu S., Finniss S., Lee H.K., Ziv-Av A., Mikkelsen T., Brodie C.Biochem. Biophys. Res. Commun. 362:612-618(2007) Wu J., Zhang B., Zhou Y., Peng X., Yuan J., Qiang B. Structure comparison of human glioma pathogenesis-related protein GliPR and the plant pathogenesis-related protein P14a indicates a functional link between the human immune system and a plant defense system.Szyperski T., Fernandez C., Mumenthaler C., Wuethrich K.Proc. Natl. Acad. Sci. U.S.A. 95:2262-2266(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.1 kDa
NCBI Official Full Name
glioma pathogenesis-related protein 1
NCBI Official Synonym Full Names
GLI pathogenesis-related 1
NCBI Official Symbol
GLIPR1
NCBI Official Synonym Symbols
GLIPR; RTVP1; CRISP7
NCBI Protein Information
glioma pathogenesis-related protein 1
UniProt Protein Name
Glioma pathogenesis-related protein 1
UniProt Gene Name
GLIPR1
UniProt Synonym Gene Names
GLIPR; RTVP1; GliPR 1
UniProt Entry Name
GLIP1_HUMAN

NCBI Description

This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

GLIPR1: a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q21.2

Cellular Component: extracellular region; integral to membrane; membrane; plasma membrane

Biological Process: cellular lipid metabolic process

Research Articles on GLIPR1

Similar Products

Product Notes

The GLIPR1 glipr1 (Catalog #AAA961955) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-232aa; Partial. The amino acid sequence is listed below: ANILPDIENE DFIKDCVRIH NKFRSEVKPT ASDMLYMTWD PALAQIAKAW ASNCQFSHNT RLKPPHKLHP NFTSLGENIW TGSVPIFSVS SAITNWYDEI QDYDFKTRIC KKVCGHYTQV VWADSYKVGC AVQFCPKVSG FDALSNGAHF ICNYGPGGNY PTWPYKRGAT CSACPNNDKC LDNLCVNRQR DQVKRYYSVV YPGWPIYPRN R. It is sometimes possible for the material contained within the vial of "Glioma pathogenesis-related protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.