Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP synthase lipid-binding protein, mitochondrial (ATP5G2) Recombinant Protein | ATP5G2 recombinant protein

Recombinant Bovine ATP synthase lipid-binding protein, mitochondrial (ATP5G2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase lipid-binding protein; mitochondrial (ATP5G2); Recombinant Bovine ATP synthase lipid-binding protein; Recombinant ATP synthase lipid-binding protein; mitochondrial; ATP synthase proteolipid P2 ATPase protein 9 ATPase subunit c; ATP5G2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
69-143
Sequence
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Sequence Length
143
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,029 Da
NCBI Official Full Name
ATP synthase lipid-binding protein, mitochondrial
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)<
NCBI Official Symbol
ATP5G2
NCBI Protein Information
ATP synthase lipid-binding protein, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P2; mit-ATP synthase proteolipid P2 subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9)
UniProt Protein Name
ATP synthase lipid-binding protein, mitochondrial
UniProt Gene Name
ATP5G2
UniProt Entry Name
AT5G2_BOVIN

Uniprot Description

Function: Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.

Subunit structure: F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c.

Subcellular location: Mitochondrion membrane; Multi-pass membrane protein.

Involvement in disease: Note=This protein is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease).

Miscellaneous: There are three genes which encode the ATP synthase proteolipid and they specify precursors with different import sequences but identical mature proteins.

Sequence similarities: Belongs to the ATPase C chain family.

Similar Products

Product Notes

The ATP5G2 atp5g2 (Catalog #AAA961560) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 69-143. The amino acid sequence is listed below: DIDTAAKFIG AGAATVGVAG SGAGIGTVFG SLIIGYARNP SLKQQLFSYA ILGFALSEAM GLFCLMVAFL ILFAM. It is sometimes possible for the material contained within the vial of "ATP synthase lipid-binding protein, mitochondrial (ATP5G2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.