tRNA (guanine-N (7)-)-methyltransferase subunit WDR4 (WDR4) Recombinant Protein | WDR4 recombinant protein
Recombinant Human tRNA (guanine-N (7)-)-methyltransferase subunit WDR4 (WDR4)
Gene Names
WDR4; TRM82; TRMT82
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
tRNA (guanine-N (7)-)-methyltransferase subunit WDR4 (WDR4); Recombinant Human tRNA (guanine-N (7)-)-methyltransferase subunit WDR4 (WDR4); WDR4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-412, Full length protein
Sequence
AGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC
Sequence Length
411
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for WDR4 recombinant protein
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,946 Da
NCBI Official Full Name
tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 isoform 2
NCBI Official Synonym Full Names
WD repeat domain 4
NCBI Official Symbol
WDR4
NCBI Official Synonym Symbols
TRM82; TRMT82
NCBI Protein Information
tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
UniProt Protein Name
tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
Protein Family
UniProt Gene Name
WDR4
NCBI Description
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2012]
Uniprot Description
Required for the formation of N7-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit.
Research Articles on WDR4
Similar Products
Product Notes
The WDR4 wdr4 (Catalog #AAA960739) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-412, Full length protein. The amino acid sequence is listed below: AGSVGLALCG QTLVVRGGSR FLATSIASSD DDSLFIYDCS AAEKKSQENK GEDAPLDQGS GAILASTFSK SGSYFALTDD SKRLILFRTK PWQCLSVRTV ARRCTALTFI ASEEKVLVAD KSGDVYSFSV LEPHGCGRLE LGHLSMLLDV AVSPDDRFIL TADRDEKIRV SWAAAPHSIE SFCLGHTEFV SRISVVPTQP GLLLSSSGDG TLRLWEYRSG RQLHCCHLAS LQELVDPQAP QKFAASRIAF WCQENCVALL CDGTPVVYIF QLDARRQQLV YRQQLAFQHQ VWDVAFEETQ GLWVLQDCQE APLVLYRPVG DQWQSVPEST VLKKVSGVLR GNWAMLEGSA GADASFSSLY KATFDNVTSY LKKKEERLQQ QLEKKQRRRS PPPGPDGHAK KMRPGEATLS C. It is sometimes possible for the material contained within the vial of "tRNA (guanine-N (7)-)-methyltransferase subunit WDR4 (WDR4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
