Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glycoprotein hormones alpha chain (CGA) Recombinant Protein | CGA recombinant protein

Recombinant Human Glycoprotein hormones alpha chain (CGA)

Gene Names
CGA; HCG; LHA; FSHA; GPHa; TSHA; GPHA1; CG-ALPHA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycoprotein hormones alpha chain (CGA); Recombinant Human Glycoprotein hormones alpha chain (CGA); Glycoprotein hormones alpha chain; Anterior pituitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha; CG-alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; CGA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-116. Full Length of Mature Protein
Sequence
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,075 Da
NCBI Official Full Name
glycoprotein hormones alpha chain isoform 2
NCBI Official Synonym Full Names
glycoprotein hormones, alpha polypeptide
NCBI Official Symbol
CGA
NCBI Official Synonym Symbols
HCG; LHA; FSHA; GPHa; TSHA; GPHA1; CG-ALPHA
NCBI Protein Information
glycoprotein hormones alpha chain; FSH-alpha; LSH-alpha; TSH-alpha; lutropin alpha chain; follitropin alpha chain; thyrotropin alpha chain; choriogonadotropin alpha chain; luteinizing hormone alpha chain; chorionic gonadotrophin subunit alpha; thyroid-stimulating hormone alpha chain; follicle-stimulating hormone alpha chain; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha subunit; anterior pituitary glycoprotein hormones common subunit alpha
UniProt Protein Name
Glycoprotein hormones alpha chain
Protein Family
UniProt Gene Name
CGA
UniProt Synonym Gene Names
CG-alpha; FSH-alpha; LSH-alpha; TSH-alpha
UniProt Entry Name
GLHA_HUMAN

NCBI Description

The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

CGA: The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6q12-q21

Cellular Component: extracellular region

Molecular Function: protein binding; hormone activity

Biological Process: cellular protein metabolic process; cell-cell signaling; peptide hormone processing; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; signal transduction; positive regulation of cell migration

Research Articles on CGA

Similar Products

Product Notes

The CGA cga (Catalog #AAA958951) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-116. Full Length of Mature Protein. The amino acid sequence is listed below: APDVQDCPEC TLQENPFFSQ PGAPILQCMG CCFSRAYPTP LRSKKTMLVQ KNVTSESTCC VAKSYNRVTV MGGFKVENHT ACHCSTCYYH KS. It is sometimes possible for the material contained within the vial of "Glycoprotein hormones alpha chain (CGA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.