Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) Recombinant Protein | COX4I1 recombinant protein
Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)
Gene Names
COX4I1; COX4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase subunit 4 isoform 1; mitochondrial (COX4I1); Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1; Recombinant Cytochrome c oxidase subunit 4 isoform 1; mitochondrial; Cytochrome c oxidase polypeptide IV Cytochrome c oxidase subunit IV isoform 1; COX IV-1; COX4I1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-169
Sequence
AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK
Sequence Length
169
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,572 Da
NCBI Official Full Name
cytochrome c oxidase subunit 4 isoform 1, mitochondrial
NCBI Official Symbol
COX4I1
NCBI Official Synonym Symbols
COX4
NCBI Protein Information
cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX IV-1; cytochrome c oxydase subunit 4; cytochrome c oxidase polypeptide IV
UniProt Protein Name
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Protein Family
UniProt Gene Name
COX4I1
UniProt Synonym Gene Names
COX4; COX IV-1
UniProt Entry Name
COX41_BOVIN
Uniprot Description
COX4I1: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Ubiquitous. Belongs to the cytochrome c oxidase IV family.
Protein type: Oxidoreductase; EC 1.9.3.1; Mitochondrial; Energy Metabolism - oxidative phosphorylation; Membrane protein, integral
Cellular Component: integral to membrane; mitochondrial respiratory chain complex IV; nucleus
Molecular Function: cytochrome-c oxidase activity
Research Articles on COX4I1
Similar Products
Product Notes
The COX4I1 cox4i1 (Catalog #AAA958811) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-169. The amino acid sequence is listed below: AHGSVVKSED YALPSYVDRR DYPLPDVAHV KNLSASQKAL KEKEKASWSS LSIDEKVELY RLKFKESFAE MNRSTNEWKT VVGAAMFFIG FTALLLIWEK HYVYGPIPHT FEEEWVAKQT KRMLDMKVAP IQGFSAKWDY DKNEWKK. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
