Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Antigen peptide transporter 1 (Tap1) Recombinant Protein | Tap1 recombinant protein

Recombinant Mouse Antigen peptide transporter 1 (Tap1), partial

Gene Names
Tap1; Y3; TAP; APT1; Ham1; MTP1; PSF1; ABC17; Abcb2; Ham-1; RING4; Tap-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Antigen peptide transporter 1 (Tap1); Recombinant Mouse Antigen peptide transporter 1 (Tap1); partial; Tap1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
441-724. Partial
Sequence
YPSMQKAVGSSEKIFEYLDRTPCSPLSGSLAPSNMKGLVEFQDVSFAYPNQPKVQVLQGLTFTLHPGTVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGQCLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLNRTPTMEEITAVAVESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPLLLILDDATSALDAGNQLRVQRLLYESPKRASRTVLLITQQLSLAEQAHHILFLREGSVGEQGTHLQLMKRGGCYRAMVEALAAPAD
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,864 Da
NCBI Official Full Name
antigen peptide transporter 1 isoform 1
NCBI Official Synonym Full Names
transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
NCBI Official Symbol
Tap1
NCBI Official Synonym Symbols
Y3; TAP; APT1; Ham1; MTP1; PSF1; ABC17; Abcb2; Ham-1; RING4; Tap-1
NCBI Protein Information
antigen peptide transporter 1
UniProt Protein Name
Antigen peptide transporter 1
UniProt Gene Name
Tap1
UniProt Synonym Gene Names
Abcb2; Ham-1; Ham1; APT1

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This protein forms a heterodimer with Tap2 that transports short peptides from the cytosol into the endoplasmic reticulum lumen. Mutations in the human gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2009]

Uniprot Description

Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin ().

Research Articles on Tap1

Similar Products

Product Notes

The Tap1 tap1 (Catalog #AAA958619) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 441-724. Partial. The amino acid sequence is listed below: YPSMQKAVGS SEKIFEYLDR TPCSPLSGSL APSNMKGLVE FQDVSFAYPN QPKVQVLQGL TFTLHPGTVT ALVGPNGSGK STVAALLQNL YQPTGGQLLL DGQCLVQYDH HYLHTQVAAV GQEPLLFGRS FRENIAYGLN RTPTMEEITA VAVESGAHDF ISGFPQGYDT EVGETGNQLS GGQRQAVALA RALIRKPLLL ILDDATSALD AGNQLRVQRL LYESPKRASR TVLLITQQLS LAEQAHHILF LREGSVGEQG THLQLMKRGG CYRAMVEALA APAD . It is sometimes possible for the material contained within the vial of "Antigen peptide transporter 1 (Tap1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.