Ubiquinone biosynthesis protein COQ7 homolog (Coq7) Recombinant Protein | Coq7 recombinant protein
Recombinant Mouse Ubiquinone biosynthesis protein COQ7 homolog (Coq7)
Gene Names
Coq7; clk-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquinone biosynthesis protein COQ7 homolog (Coq7); Recombinant Mouse Ubiquinone biosynthesis protein COQ7 homolog (Coq7); Coq7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-217, Full length protein
Sequence
HSSGMTLDNINRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAAIYLSERF
Sequence Length
183
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Coq7 recombinant protein
This protein is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Transcript variants have been described for this gene, but their full-length sequences have not been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,042 Da
NCBI Official Full Name
5-demethoxyubiquinone hydroxylase, mitochondrial isoform 1
NCBI Official Synonym Full Names
demethyl-Q 7
NCBI Official Symbol
Coq7
NCBI Official Synonym Symbols
clk-1
NCBI Protein Information
5-demethoxyubiquinone hydroxylase, mitochondrial
UniProt Protein Name
5-demethoxyubiquinone hydroxylase, mitochondrial
Protein Family
UniProt Gene Name
Coq7
UniProt Synonym Gene Names
DMQ hydroxylase
Uniprot Description
Catalyzes the hydroxylation of 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2) during ubiquinone biosynthesis. Has also a structural role in the COQ enzyme complex, stabilizing other COQ polypeptides (). Involved in lifespan determination in a ubiquinone-independent manner (PubMed:19478076).
Research Articles on Coq7
Similar Products
Product Notes
The Coq7 coq7 (Catalog #AAA958510) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-217, Full length protein. The amino acid sequence is listed below: HSSGMTLDNI NRAAVDRIIR VDHAGEYGAN RIYAGQMAVL GRTSVGPVIQ KMWDQEKNHL KKFNELMIAF RVRPTVLMPL WNVAGFALGA GTALLGKEGA MACTVAVEES IANHYNNQIR MLMEEDPEKY EELLQVIKQF RDEELEHHDT GLDHDAELAP AYALLKRIIQ AGCSAAIYLS ERF. It is sometimes possible for the material contained within the vial of "Ubiquinone biosynthesis protein COQ7 homolog (Coq7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
