Myosin light polypeptide 6 (MYL6) Recombinant Protein | MYL6 recombinant protein

Recombinant Human Myosin light polypeptide 6 (MYL6)

Cat. Num. AAA958415

• Gene Names: MYL6; LC17; ESMLC; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM; LC17-GI; LC17-NM
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myosin light polypeptide 6 (MYL6); Recombinant Human Myosin light polypeptide 6 (MYL6); MYL6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-151, Full length protein
• Sequence: CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
• Sequence Length: 150

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for MYL6 recombinant protein

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 17986258
• NCBI GeneID: 4637
• NCBI Accession #: NP_066299.2
• NCBI GenBank Nucleotide #: NM_021019.4
• UniProt Accession #: P60660; P16475; P24572; P24573; Q12790; Q561V9; Q6IAZ0; Q6IPY5
• Molecular Weight: 16,961 Da
• NCBI Official Full Name: myosin light polypeptide 6 isoform 1
• NCBI Official Synonym Full Names: myosin light chain 6
• NCBI Official Symbol: MYL6
• NCBI Official Synonym Symbols: LC17; ESMLC; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM; LC17-GI; LC17-NM
• NCBI Protein Information: myosin light polypeptide 6
• UniProt Protein Name: Myosin light polypeptide 6
• Protein Family: Myosin light polypeptide
• UniProt Gene Name: MYL6
• UniProt Synonym Gene Names: LC17; MLC-3; Myosin light chain A3

NCBI Description

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Regulatory light chain of myosin. Does not bind calcium.