Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Short-wave-sensitive opsin 1 (Opn1sw) Recombinant Protein | Opn1sw recombinant protein

Recombinant Mouse Short-wave-sensitive opsin 1 (Opn1sw)

Gene Names
Opn1sw; Bcp; AW551857
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Short-wave-sensitive opsin 1 (Opn1sw); Recombinant Mouse Short-wave-sensitive opsin 1 (Opn1sw); Recombinant Short-wave-sensitive opsin 1 (Opn1sw); Short-wave-sensitive opsin 1; S opsin; Blue cone photoreceptor pigment Blue-sensitive opsin; BOP Short wavelength-sensitive cone opsin; Opn1sw recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-346
Sequence
MSGEDDFYLFQNISSVGPWDGPQYHLAPVWAFRLQAAFMGFVFFVGTPLNAIVLVATLHYKKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTGWSLAFLAFERYVVICKPFGSIRFNSKHALMVVLATWIIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESATTQKAEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLDLRLVTIPAFFSKSSCVYNPIIYCFMNKQFRACILEMVCRKPMADESDVSGSQKTEVSTVSSSKVGPH
Sequence Length
346
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,922 Da
NCBI Official Full Name
short-wave-sensitive opsin 1
NCBI Official Synonym Full Names
opsin 1 (cone pigments), short-wave-sensitive (color blindness, tritan)
NCBI Official Symbol
Opn1sw
NCBI Official Synonym Symbols
Bcp; AW551857
NCBI Protein Information
short-wave-sensitive opsin 1; BOP; S opsin; SWS opsin; blue opsin; blue/UV opsin; UV cone pigment; blue cone opsin; blue cone pigment; blue-sensitive opsin; blue cone photoreceptor pigment; short wavelength sensitive opsin; short wavelength-sensitive cone opsin
UniProt Protein Name
Short-wave-sensitive opsin 1
UniProt Gene Name
Opn1sw
UniProt Synonym Gene Names
Bcp; S opsin; BOP
UniProt Entry Name
OPSB_MOUSE

Uniprot Description

OPN1SW: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. Defects in OPN1SW are the cause of tritan color blindness (CBT). Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1

Cellular Component: photoreceptor outer segment; membrane; integral to membrane; terminal button

Molecular Function: G-protein coupled receptor activity; signal transducer activity; photoreceptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; visual perception; response to stimulus; phototransduction; signal transduction; protein-chromophore linkage

Disease: Tritanopia

Research Articles on Opn1sw

Similar Products

Product Notes

The Opn1sw opn1sw (Catalog #AAA958146) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-346. The amino acid sequence is listed below: MSGEDDFYLF QNISSVGPWD GPQYHLAPVW AFRLQAAFMG FVFFVGTPLN AIVLVATLHY KKLRQPLNYI LVNVSLGGFL FCIFSVFTVF IASCHGYFLF GRHVCALEAF LGSVAGLVTG WSLAFLAFER YVVICKPFGS IRFNSKHALM VVLATWIIGI GVSIPPFFGW SRFIPEGLQC SCGPDWYTVG TKYRSEYYTW FLFIFCFIIP LSLICFSYSQ LLRTLRAVAA QQQESATTQK AEREVSHMVV VMVGSFCLCY VPYAALAMYM VNNRNHGLDL RLVTIPAFFS KSSCVYNPII YCFMNKQFRA CILEMVCRKP MADESDVSGS QKTEVSTVSS SKVGPH. It is sometimes possible for the material contained within the vial of "Short-wave-sensitive opsin 1 (Opn1sw), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.