Ubiquitin-conjugating enzyme E2 E1 (UBE2E1) Recombinant Protein | UBE2E1 recombinant protein
Recombinant Human Ubiquitin-conjugating enzyme E2 E1 (UBE2E1)
Gene Names
UBE2E1; UBCH6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-conjugating enzyme E2 E1 (UBE2E1); Recombinant Human Ubiquitin-conjugating enzyme E2 E1 (UBE2E1); UBE2E1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-193, Full length protein
Sequence
SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Sequence Length
192
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for UBE2E1 recombinant protein
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,499 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 E1 isoform 3
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 E1
NCBI Official Symbol
UBE2E1
NCBI Official Synonym Symbols
UBCH6
NCBI Protein Information
ubiquitin-conjugating enzyme E2 E1
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 E1
Protein Family
UniProt Gene Name
UBE2E1
UniProt Synonym Gene Names
UBCH6
NCBI Description
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Uniprot Description
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination.
Research Articles on UBE2E1
Similar Products
Product Notes
The UBE2E1 ube2e1 (Catalog #AAA958060) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-193, Full length protein. The amino acid sequence is listed below: SDDDSRASTS SSSSSSSNQQ TEKETNTPKK KESKVSMSKN SKLLSTSAKR IQKELADITL DPPPNCSAGP KGDNIYEWRS TILGPPGSVY EGGVFFLDIT FTPEYPFKPP KVTFRTRIYH CNINSQGVIC LDILKDNWSP ALTISKVLLS ICSLLTDCNP ADPLVGSIAT QYMTNRAEHD RMARQWTKRY AT. It is sometimes possible for the material contained within the vial of "Ubiquitin-conjugating enzyme E2 E1 (UBE2E1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
