Alpha-synuclein Recombinant Protein | SNCA recombinant protein

Recombinant Human Alpha-synuclein protein

Cat. Num. AAA957854

• Gene Names: SNCA; PD1; NACP; PARK1; PARK4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Alpha-synuclein; Recombinant Human Alpha-synuclein protein; Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP; SNCA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-140aa; Full Length
• Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for SNCA recombinant protein

May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Product Categories/Family for SNCA recombinant protein

Neuroscience

References

Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease.Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M., Otero D.A., Kondo J., Ihara Y., Saitoh T.Proc. Natl. Acad. Sci. U.S.A. 90:11282-11286(1993)

NCBI and Uniprot Product Information

• NCBI GI #: 4507109
• NCBI GeneID: 6622
• NCBI Accession #: NP_000336.1
• NCBI GenBank Nucleotide #: NM_000345.3
• UniProt Accession #: P37840; Q13701; Q4JHI3; Q6IAU6; A8K2A4
• Molecular Weight: 16.5 kDa
• NCBI Official Full Name: alpha-synuclein isoform NACP140
• NCBI Official Synonym Full Names: synuclein alpha
• NCBI Official Symbol: SNCA
• NCBI Official Synonym Symbols: PD1; NACP; PARK1; PARK4
• NCBI Protein Information: alpha-synuclein
• UniProt Protein Name: Alpha-synuclein
• Protein Family: Alpha-synuclein
• UniProt Gene Name: SNCA
• UniProt Synonym Gene Names: NACP; PARK1; NACP
• UniProt Entry Name: SYUA_HUMAN

NCBI Description

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

SNCA: a member of the synuclein family. Abundantly expressed in the brain. Inhibits phospholipase D2 selectively. May integrate presynaptic signaling and membrane trafficking. Implicated in the pathogenesis of Parkinson's disease. A major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced isoforms transcripts have been identified.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: actin cytoskeleton; axon; cell cortex; cell junction; cytoplasm; cytosol; extracellular region; extracellular space; fibril; Golgi apparatus; growth cone; inclusion body; lysosome; membrane; mitochondrial respiratory chain complex I; mitochondrion; nuclear outer membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; platelet alpha granule membrane; ribosome; rough endoplasmic reticulum; synaptic vesicle; terminal button

Molecular Function: alpha-tubulin binding; beta-tubulin binding; calcium ion binding; caspase inhibitor activity; copper ion binding; dynein binding; fatty acid binding; ferrous iron binding; histone binding; identical protein binding; kinesin binding; magnesium ion binding; microtubule binding; oxidoreductase activity; phospholipase binding; phospholipid binding; phosphoprotein binding; protein binding; protein domain specific binding; protein N-terminus binding; tau protein binding; zinc ion binding

Biological Process: adult locomotory behavior; aging; behavioral response to cocaine; calcium ion homeostasis; caspase activation; cellular protein metabolic process; dopamine biosynthetic process; dopamine uptake; fatty acid metabolic process; fibril organization and biogenesis; microglial cell activation; mitochondrial membrane organization and biogenesis; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of dopamine metabolic process; negative regulation of dopamine uptake; negative regulation of exocytosis; negative regulation of histone acetylation; negative regulation of microtubule polymerization; negative regulation of monooxygenase activity; negative regulation of neuron apoptosis; negative regulation of norepinephrine uptake; negative regulation of protein amino acid phosphorylation; negative regulation of serotonin uptake; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transporter activity; neutral lipid metabolic process; organelle ATP synthesis coupled electron transport; phospholipid metabolic process; positive regulation of apoptosis; positive regulation of endocytosis; positive regulation of neurotransmitter secretion; positive regulation of peptidyl-serine phosphorylation; positive regulation of receptor recycling; positive regulation of release of sequestered calcium ion into cytosol; protein destabilization; receptor internalization; regulation of acyl-CoA biosynthetic process; regulation of dopamine secretion; regulation of excitatory postsynaptic membrane potential; regulation of glutamate secretion; regulation of locomotion; regulation of long-term neuronal synaptic plasticity; regulation of macrophage activation; response to drug; response to iron(II) ion; response to lipopolysaccharide; response to magnesium ion; synapse organization and biogenesis; synaptic vesicle endocytosis

Disease: Dementia, Lewy Body; Parkinson Disease 1, Autosomal Dominant; Parkinson Disease 4, Autosomal Dominant