Stanniocalcin-2 (STC2) Recombinant Protein | STC2 recombinant protein
Recombinant Guinea pig Stanniocalcin-2 (STC2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Stanniocalcin-2 (STC2); Recombinant Guinea pig Stanniocalcin-2 (STC2); STC2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-197, Full length protein
Sequence
TDAXNPPEGPQDRGSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNXCXIXXLHXISFIKAHALRFGCISREMVFQLQRECYLKHDLCMINFRDLLLHEPYVDLVNLLLTCGEDVKEAVTRSIQAQCEQNWGGLCSILSFCTSNVQRPXAXQPXADRAQVSRPHHHDTGHHLLEAIXGAKGERGSKSHPSVRA
Sequence Length
197
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for STC2 recombinant protein
This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium
phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers.
phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
21,911 Da
NCBI Official Full Name
Stanniocalcin-2
UniProt Protein Name
Stanniocalcin-2
Protein Family
UniProt Gene Name
STC2
UniProt Synonym Gene Names
STC-2
Uniprot Description
Has an anti-hypocalcemic action on calcium and phosphate homeostasis.
Similar Products
Product Notes
The STC2 stc2 (Catalog #AAA957786) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-197, Full length protein. The amino acid sequence is listed below: TDAXNPPEGP QDRGSQQKGR LSLQNTAEIQ HCLVNAGDVG CGVFECFENN XCXIXXLHXI SFIKAHALRF GCISREMVFQ LQRECYLKHD LCMINFRDLL LHEPYVDLVN LLLTCGEDVK EAVTRSIQAQ CEQNWGGLCS ILSFCTSNVQ RPXAXQPXAD RAQVSRPHHH DTGHHLLEAI XGAKGERGSK SHPSVRA. It is sometimes possible for the material contained within the vial of "Stanniocalcin-2 (STC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
