Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ubiquitin-like protein 4A (Ubl4a) Recombinant Protein | Ubl4a recombinant protein

Recombinant Mouse Ubiquitin-like protein 4A (Ubl4a)

Gene Names
Gm44504; Tu11; Gm38419; SlcUbl4a; Slc10a3-ubl4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-like protein 4A (Ubl4a); Recombinant Mouse Ubiquitin-like protein 4A (Ubl4a); Ubl4a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-157, Full length protein
Sequence
MQLTVKALQGRECSLQVAEDELVSTLKHLVSDKLNVPVRQQRLLFKGKALADEKRLSDYNIGPNSKLNLVVKPLEKVLLEEGSAHRLVDSPATPIWQLISKVLARHFSVADASRVLEQLQRDYDRSLSRLTLDDIERLASRFLHPEVTEAMEKGFCK
Sequence Length
157
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,801 Da
NCBI Official Full Name
ubiquitin-like protein 4A
NCBI Official Synonym Full Names
predicted readthrough transcript (NMD candidate), 44504
NCBI Official Symbol
Gm44504
NCBI Official Synonym Symbols
Tu11; Gm38419; SlcUbl4a; Slc10a3-ubl4
NCBI Protein Information
ubiquitin-like protein 4A
UniProt Protein Name
Ubiquitin-like protein 4A
Protein Family
UniProt Gene Name
Ubl4a
UniProt Synonym Gene Names
Gdx; Ubl4

NCBI Description

This locus represents naturally occurring readthrough transcription between the neighboring Slc10a3 (solute carrier family 10 (sodium/bile acid cotransporter family), member 3) and Ubl4 (ubiquitin-like 4) genes on chromosome X. While some readthrough transcripts encode a protein that is identical to the downstream gene product, at least one readthrough transcript appears to be a candidate for nonsense-mediated mRNA decay (NMD), and is unlikely to produce a protein product. [provided by RefSeq, May 2013]

Uniprot Description

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Similar Products

Product Notes

The Ubl4a ubl4a (Catalog #AAA957233) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-157, Full length protein. The amino acid sequence is listed below: MQLTVKALQG RECSLQVAED ELVSTLKHLV SDKLNVPVRQ QRLLFKGKAL ADEKRLSDYN IGPNSKLNLV VKPLEKVLLE EGSAHRLVDS PATPIWQLIS KVLARHFSVA DASRVLEQLQ RDYDRSLSRL TLDDIERLAS RFLHPEVTEA MEKGFCK. It is sometimes possible for the material contained within the vial of "Ubiquitin-like protein 4A (Ubl4a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.