Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Quinone oxidoreductase (Cryz) Recombinant Protein | Cryz recombinant protein

Recombinant Mouse Quinone oxidoreductase (Cryz)

Gene Names
Cryz; Sez9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Quinone oxidoreductase (Cryz); Recombinant Mouse Quinone oxidoreductase (Cryz); Cryz recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-331, Full length protein
Sequence
ATGQKLMRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKVSAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGSGKTGKMILLL
Sequence Length
330
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cryz recombinant protein
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,269 Da
NCBI Official Full Name
quinone oxidoreductase
NCBI Official Synonym Full Names
crystallin, zeta
NCBI Official Symbol
Cryz
NCBI Official Synonym Symbols
Sez9
NCBI Protein Information
quinone oxidoreductase
UniProt Protein Name
Quinone oxidoreductase
Protein Family
UniProt Gene Name
Cryz

Uniprot Description

Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification of xenobiotics. Interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species and enhances their stability. NADPH binding interferes with mRNA binding ().

Research Articles on Cryz

Similar Products

Product Notes

The Cryz cryz (Catalog #AAA956886) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-331, Full length protein. The amino acid sequence is listed below: ATGQKLMRAI RVFEFGGPEV LKLQSDVVVP VPQSHQVLIK VHACGVNPVE TYIRSGAYSR KPALPYTPGS DVAGIIESVG DKVSAFKKGD RVFCYSTVSG GYAEFALAAD DTIYPLPETL NFRQGAALGI PYFTACRALF HSARARAGES VLVHGASGGV GLATCQIARA HGLKVLGTAG SEEGKKLVLQ NGAHEVFNHK EANYIDKIKM SVGDKDKGVD VIIEMLANEN LSNDLKLLSH GGRVVVVGCR GPIEINPRDT MAKETSIIGV SLSSSTKEEF QQFAGLLQAG IEKGWVKPVI GSEYPLEKAA QAHEDIIHGS GKTGKMILLL. It is sometimes possible for the material contained within the vial of "Quinone oxidoreductase (Cryz), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.