Cathepsin D (Ctsd) Recombinant Protein | Ctsd recombinant protein
Recombinant Rat Cathepsin D (Ctsd)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathepsin D (Ctsd); Recombinant Rat Cathepsin D (Ctsd); Ctsd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
65-407, Full length protein
Sequence
EPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQPGVVFIAAKFDGILGMGYPFISVNKVLPVFDNLMKQKLVEKNIFSFYLNRDPTGQPGGELMLGGTDSRYYHGELSYLNVTRKAYWQVHMDQLEVGSELTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPIITFKLGGQNYELHPEKYILKVSQAGKTICLSGFMGMDIPPPSGPLWILGDVFIGCYYTVFDREYNRVGFAKAATL
Sequence Length
343
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ctsd recombinant protein
This gene encodes a lysosomal aspartyl protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This proteinase, which is a member of the peptidase C1 family, has a specificity similar to but narrower than that of pepsin A. Transcription of this gene is initiated from several sites, including one which is a start site for an estrogen-regulated transcript. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44,681 Da
NCBI Official Full Name
Cathepsin D
NCBI Official Synonym Full Names
cathepsin D
NCBI Official Symbol
Ctsd
NCBI Protein Information
cathepsin D
UniProt Protein Name
Cathepsin D
Protein Family
UniProt Gene Name
Ctsd
NCBI Description
lysosomal aspartic endopeptidase [RGD, Feb 2006]
Uniprot Description
Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation.
Research Articles on Ctsd
Similar Products
Product Notes
The Ctsd ctsd (Catalog #AAA956132) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 65-407, Full length protein. The amino acid sequence is listed below: EPVSELLKNY LDAQYYGEIG IGTPPQCFTV VFDTGSSNLW VPSIHCKLLD IACWVHHKYN SDKSSTYVKN GTSFDIHYGS GSLSGYLSQD TVSVPCKSDL GGIKVEKQIF GEATKQPGVV FIAAKFDGIL GMGYPFISVN KVLPVFDNLM KQKLVEKNIF SFYLNRDPTG QPGGELMLGG TDSRYYHGEL SYLNVTRKAY WQVHMDQLEV GSELTLCKGG CEAIVDTGTS LLVGPVDEVK ELQKAIGAVP LIQGEYMIPC EKVSSLPIIT FKLGGQNYEL HPEKYILKVS QAGKTICLSG FMGMDIPPPS GPLWILGDVF IGCYYTVFDR EYNRVGFAKA ATL. It is sometimes possible for the material contained within the vial of "Cathepsin D (Ctsd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
