Myelin and lymphocyte protein (MAL) Recombinant Protein | MAL recombinant protein

Recombinant Human Myelin and lymphocyte protein (MAL)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myelin and lymphocyte protein (MAL); Recombinant Human Myelin and lymphocyte protein (MAL); Recombinant Myelin and lymphocyte protein (MAL); Myelin and lymphocyte protein; T-lymphocyte maturation-associated protein; MAL recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-153
• Sequence: MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS
• Sequence Length: 153

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 4505091
• NCBI GeneID: 4118
• NCBI Accession #: NP_002362.1
• NCBI GenBank Nucleotide #: NM_002371.3
• UniProt Accession #: P21145; Q6FH77
• Molecular Weight: 16,714 Da
• NCBI Official Full Name: myelin and lymphocyte protein isoform a
• NCBI Official Synonym Full Names: mal, T-cell differentiation protein
• NCBI Official Symbol: MAL
• NCBI Protein Information: myelin and lymphocyte protein; T-lymphocyte maturation-associated protein
• UniProt Protein Name: Myelin and lymphocyte protein
• Protein Family: Myelin and lymphocyte protein
• UniProt Gene Name: MAL
• UniProt Entry Name: MAL_HUMAN

NCBI Description

The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. [provided by RefSeq, May 2012]

Uniprot Description

MAL: Could be an important component in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane. Could be involved in myelin biogenesis and/or myelin function. Belongs to the MAL family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q11.1

Cellular Component: extrinsic to membrane; integral to plasma membrane; endoplasmic reticulum; apical plasma membrane; endosome; lipid raft

Molecular Function: protein binding; structural constituent of myelin sheath; channel activity; apoptotic protease activator activity; lipid binding

Biological Process: myelination; apical protein localization; central nervous system development; apoptosis; cell differentiation; lipid raft polarization; transmembrane transport