Synaptic vesicular amine transporter (SLC18A2) Recombinant Protein | SLC18A2 recombinant protein
Recombinant Human Synaptic vesicular amine transporter (SLC18A2), partial
Gene Names
SLC18A2; SVAT; SVMT; VAT2; VMAT2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptic vesicular amine transporter (SLC18A2); Recombinant Human Synaptic vesicular amine transporter (SLC18A2); partial; SLC18A2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-514
Sequence
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Sequence Length
514
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,980 Da
NCBI Official Full Name
synaptic vesicular amine transporter
NCBI Official Synonym Full Names
solute carrier family 18 member A2
NCBI Official Symbol
SLC18A2
NCBI Official Synonym Symbols
SVAT; SVMT; VAT2; VMAT2
NCBI Protein Information
synaptic vesicular amine transporter
UniProt Protein Name
Synaptic vesicular amine transporter
Protein Family
UniProt Gene Name
SLC18A2
UniProt Synonym Gene Names
SVMT; VMAT2; VAT2
NCBI Description
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (summary by Peter et al., 1993 [PubMed 7905859]). See also SLC18A1 (MIM 193002).[supplied by OMIM, Jan 2011]
Uniprot Description
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
Research Articles on SLC18A2
Similar Products
Product Notes
The SLC18A2 slc18a2 (Catalog #AAA954690) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-514. The amino acid sequence is listed below: MALSELALVR WLQESRRSRK LILFIVFLAL LLDNMLLTVV VPIIPSYLYS IKHEKNATEI QTARPVHTAS ISDSFQSIFS YYDNSTMVTG NATRDLTLHQ TATQHMVTNA SAVPSDCPSE DKDLLNENVQ VGLLFASKAT VQLITNPFIG LLTNRIGYPI PIFAGFCIMF VSTIMFAFSS SYAFLLIARS LQGIGSSCSS VAGMGMLASV YTDDEERGNV MGIALGGLAM GVLVGPPFGS VLYEFVGKTA PFLVLAALVL LDGAIQLFVL QPSRVQPESQ KGTPLTTLLK DPYILIAAGS ICFANMGIAM LEPALPIWMM ETMCSRKWQL GVAFLPASIS YLIGTNIFGI LAHKMGRWLC ALLGMIIVGV SILCIPFAKN IYGLIAPNFG VGFAIGMVDS SMMPIMGYLV DLRHVSVYGS VYAIADVAFC MGYAIGPSAG GAIAKAIGFP WLMTIIGIID ILFAPLCFFL RSPPAKEEKM AILMDHNCPI KTKMYTQNNI QSYPIGEDEE SESD. It is sometimes possible for the material contained within the vial of "Synaptic vesicular amine transporter (SLC18A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
