Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neurogenic locus notch homolog protein 4 (Notch4) Recombinant Protein | Notch4 recombinant protein

Recombinant Mouse Neurogenic locus notch homolog protein 4 (Notch4) , partial

Gene Names
Notch4; N4; Int3; Int-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurogenic locus notch homolog protein 4 (Notch4); Recombinant Mouse Neurogenic locus notch homolog protein 4 (Notch4); partial; Notch4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1463-1964aa, Notch 4 intracellular domain
Sequence
VLQLIRRRRREHGALWLPPGFIRRPQAQQAPHRRRPPLGEDNIGLKALKPEAEVDEDGVA MCSGPEEGEAEETASASRCQLWPLNSSCGELPQAAMLTPPQECESEVLDVDTCGPDGV TPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGACPQAHTVGTGETPLHLAARF SRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLLLASRQTSVDARTEDGTTP LMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVNNARAARSLLQAGADKDAQ DSREQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGLAPGDVARQRSHWDLLTLLEGA GPTTQEARAHARTTPGGGAAARCRTLSAGARPRGGGACLQARTWSVDLGARGGKVYAR CRSRSGSCGGPTTRGRRFSAGSRGRRGARASQDDWPRDWVALEACGSACSAPIPPPSL TPSPERGSPQVAWGLPVHQEIPLNSVVRNLN
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Notch4 recombinant protein
This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. This gene may be associated with susceptibility to schizophrenia in a small portion of cases. An alternative splice variant has been described but its biological nature has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
206,693 Da
NCBI Official Full Name
neurogenic locus notch homolog protein 4
NCBI Official Synonym Full Names
notch 4
NCBI Official Symbol
Notch4
NCBI Official Synonym Symbols
N4; Int3; Int-3
NCBI Protein Information
neurogenic locus notch homolog protein 4
UniProt Protein Name
Neurogenic locus notch homolog protein 4
UniProt Gene Name
Notch4
UniProt Synonym Gene Names
Int-3; Int3; Notch 4

Uniprot Description

Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs (). May regulate branching morphogenesis in the developing vascular system.

Research Articles on Notch4

Similar Products

Product Notes

The Notch4 notch4 (Catalog #AAA953792) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1463-1964aa, Notch 4 intracellular domain. The amino acid sequence is listed below: VLQLIRRRRR EHGALWLPPG FIRRPQAQQA PHRRRPPLGE DNIGLKALKP EAEVDEDGVA MCSGPEEGEA EETASASRCQ LWPLNSSCGE LPQAAMLTPP QECESEVLDV DTCGPDGV TPLMSAVFCG GVQSTTGASP QRLGLGNLEP WEPLLDRGAC PQAHTVGTGE TPLHLAARF SRPTAARRLL EAGANPNQPD RAGRTPLHTA VAADAREVCQ LLLASRQTSV DARTEDGTTP LMLAARLAVE DLVEELIAAR ADVGARDKRG KTALHWAAAV NNARAARSLL QAGADKDAQ DSREQTPLFL AAREGAVEVA QLLLELGAAR GLRDQAGLAP GDVARQRSHW DLLTLLEGA GPTTQEARAH ARTTPGGGAA ARCRTLSAGA RPRGGGACLQ ARTWSVDLGA RGGKVYAR CRSRSGSCGG PTTRGRRFSA GSRGRRGARA SQDDWPRDWV ALEACGSACS APIPPPSL TPSPERGSPQ VAWGLPVHQE IPLNSVVRNL N. It is sometimes possible for the material contained within the vial of "Neurogenic locus notch homolog protein 4 (Notch4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.