Ubiquitin-conjugating enzyme E2 D1 (UBE2D1) Recombinant Protein | UBE2D1 recombinant protein

Recombinant Human Ubiquitin-conjugating enzyme E2 D1 (UBE2D1)

Cat. Num. AAA952573

• Gene Names: UBE2D1; SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin-conjugating enzyme E2 D1 (UBE2D1); Recombinant Human Ubiquitin-conjugating enzyme E2 D1 (UBE2D1); UBE2D1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-147, Full length protein
• Sequence: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
• Sequence Length: 147

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for UBE2D1 recombinant protein

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

NCBI and Uniprot Product Information

• NCBI GI #: 4507773
• NCBI GeneID: 7321
• NCBI Accession #: NP_003329.1
• NCBI GenBank Nucleotide #: NM_003338.4
• UniProt Accession #: P51668; A6NLF6; A8K786
• Molecular Weight: 16,602 Da
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 D1 isoform 1
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 D1
• NCBI Official Symbol: UBE2D1
• NCBI Official Synonym Symbols: SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 D1
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 D1
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2D1
• UniProt Synonym Gene Names: SFT; UBC5A; UBCH5; UBCH5A; SFT

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins (PubMed:22496338). In vitro catalyzes 'Lys-48'-linked polyubiquitination (PubMed:20061386). Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1 (PubMed:18042044, PubMed:18359941). Ubiquitinates STUB1-associated HSP90AB1 in vitro (PubMed:18042044). Lacks inherent specificity for any particular lysine residue of ubiquitin (PubMed:18042044). Essential for viral activation of IRF3 (PubMed:19854139). Mediates polyubiquitination of CYP3A4 (PubMed:19103148).