Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Sperm mitochondrial-associated cysteine-rich protein Recombinant Protein | SMCP recombinant protein

Recombinant Human Sperm mitochondrial-associated cysteine-rich protein

Gene Names
SMCP; MCS; MCSP; HSMCSGEN1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sperm mitochondrial-associated cysteine-rich protein; Recombinant Human Sperm mitochondrial-associated cysteine-rich protein; SMCP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-116aa; Full Length
Sequence
MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Sequence Length
116
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for SMCP recombinant protein
Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida.
Product Categories/Family for SMCP recombinant protein
References
Isolation, expression, and chromosomal localization of the human mitochondrial capsule selenoprotein gene (MCSP) .Aho H., Schwemmer M., Tessmann D., Murphy D., Mattei M.-G., Engel W., Adham I.M.Genomics 32:184-190(1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.8 kDa
NCBI Official Full Name
sperm mitochondrial-associated cysteine-rich protein
NCBI Official Synonym Full Names
sperm mitochondria associated cysteine rich protein
NCBI Official Symbol
SMCP
NCBI Official Synonym Symbols
MCS; MCSP; HSMCSGEN1
NCBI Protein Information
sperm mitochondrial-associated cysteine-rich protein
UniProt Protein Name
Sperm mitochondrial-associated cysteine-rich protein
UniProt Gene Name
SMCP
UniProt Synonym Gene Names
MCS; MCSP
UniProt Entry Name
MCSP_HUMAN

NCBI Description

Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath. [provided by RefSeq, Jul 2008]

Uniprot Description

SMCP: Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida.

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: cytoplasm; mitochondrial membrane; mitochondrion

Molecular Function: protein binding

Biological Process: penetration of zona pellucida; sperm motility

Research Articles on SMCP

Similar Products

Product Notes

The SMCP smcp (Catalog #AAA952447) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-116aa; Full Length. The amino acid sequence is listed below: MCDQTKHSKC CPAKGNQCCP PQQNQCCQSK GNQCCPPKQN QCCQPKGSQC CPPKHNHCCQ PKPPCCIQAR CCGLETKPEV SPLNMESEPN SPQTQDKGCQ TQQQPHSPQN ESRPSK. It is sometimes possible for the material contained within the vial of "Sperm mitochondrial-associated cysteine-rich protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.