T-cell surface glycoprotein CD3 gamma chain (CD3G) Recombinant Protein | CD3G recombinant protein

Recombinant Sheep T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

Cat. Num. AAA951529

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: T-cell surface glycoprotein CD3 gamma chain (CD3G); Recombinant Sheep T-cell surface glycoprotein CD3 gamma chain (CD3G); partial; CD3G recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-85;Provide the complete extracellular domain.
• Sequence: VKVDDNQEDGSVILICVTDEKKITWLKDMKEISSGDTNKLTWDLGSSTKDPRGIYECKGSSNESKSLQIYYRMCQNCIELNLATV
• Sequence Length: 85

• Species: Sheep
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CD3G recombinant protein

This protein is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha
beta and gamma
delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

NCBI and Uniprot Product Information

• NCBI GI #: 115995
• NCBI GeneID: 443398
• UniProt Accession #: P18439
• Molecular Weight: 16,723 Da
• NCBI Official Full Name: T-cell surface glycoprotein CD3 gamma chain
• NCBI Official Symbol: CD3G
• NCBI Protein Information: T-cell surface glycoprotein CD3 gamma chain
• UniProt Protein Name: T-cell surface glycoprotein CD3 gamma chain
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD3G

Uniprot Description

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.