T-cell surface glycoprotein CD3 epsilon chain (CD3E) Recombinant Protein | CD3E recombinant protein

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E)

Cat. Num. AAA951402

• Gene Names: CD3E; T3E; TCRE; IMD18
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: T-cell surface glycoprotein CD3 epsilon chain (CD3E); Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E); T-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD_antigen=; CD3e; CD3E recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 23-126aa; Extracellular Domain
• Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
• Sequence Length: 126

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for CD3E recombinant protein

This protein is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

NCBI and Uniprot Product Information

• NCBI GI #: 4502671
• NCBI GeneID: 916
• NCBI Accession #: NP_000724.1
• NCBI GenBank Nucleotide #: NM_000733.3
• UniProt Accession #: P07766; A8K997
• Molecular Weight: 15.8
• NCBI Official Full Name: T-cell surface glycoprotein CD3 epsilon chain
• NCBI Official Synonym Full Names: CD3e molecule, epsilon (CD3-TCR complex)
• NCBI Official Symbol: CD3E
• NCBI Official Synonym Symbols: T3E; TCRE; IMD18
• NCBI Protein Information: T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell antigen receptor complex, epsilon subunit of T3
• UniProt Protein Name: T-cell surface glycoprotein CD3 epsilon chain
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD3E
• UniProt Synonym Gene Names: T3E
• UniProt Entry Name: CD3E_HUMAN

NCBI Description

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3E: a T cell surface glycoprotein that is a component of the T cell antigen receptor. The recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. Contains 1 immunoglobulin-like domain and 1 ITAM domain.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: T cell receptor complex; integral to plasma membrane; plasma membrane; immunological synapse; alpha-beta T cell receptor complex; intercellular junction; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor signaling complex scaffold activity; protein heterodimerization activity; receptor signaling protein activity; T cell receptor binding; protein kinase binding; SH3 domain binding

Biological Process: regulation of immune response; T cell activation; positive regulation of interleukin-2 biosynthetic process; signal complex assembly; positive regulation of calcium-mediated signaling; T cell receptor signaling pathway; negative thymic T cell selection; positive regulation of interleukin-4 production; regulation of apoptosis; G-protein coupled receptor protein signaling pathway; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of interferon-gamma production; cell surface receptor linked signal transduction; negative regulation of smoothened signaling pathway; T cell costimulation; positive regulation of T cell proliferation; protein complex assembly; positive regulation of alpha-beta T cell proliferation; positive regulation of T cell anergy; response to nutrient; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Immunodeficiency 18