5-hydroxytryptamine receptor 1B (HTR1B) Recombinant Protein | HTR1B recombinant protein
Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B)
Gene Names
HTR1B; 5-HT1-LIKE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 1B (HTR1B); Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B); Recombinant 5-hydroxytryptamine receptor 1B (HTR1B); 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin 1D beta receptor; 5-HT-1D-beta Serotonin receptor 1B; HTR1B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-49aa; Fragment at the N-terminal, provide the extracellular domain.
Sequence
MEEPGAQCAPPLAAGSQIAVPQANLSAAHSHNCSAEGYIYQDSIALPWK
Species
Oryctolagus cuniculus (Rabbit)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,496 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 1B
NCBI Official Symbol
HTR1B
NCBI Official Synonym Symbols
5-HT1-LIKE
NCBI Protein Information
5-hydroxytryptamine receptor 1B; 5-HT1B; 5-HT-1B; 5-HT-1D-beta; 5-HT1D beta receptor; serotonin receptor 1B; serotonin 1D beta receptor
UniProt Protein Name
5-hydroxytryptamine receptor 1B
Protein Family
UniProt Gene Name
HTR1B
UniProt Synonym Gene Names
5-HT-1B; 5-HT1B
UniProt Entry Name
5HT1B_RABIT
Uniprot Description
Function: This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Post-translational modification: Phosphorylated
By similarity.Palmitoylated
By similarity.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The HTR1B htr1b (Catalog #AAA950136) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-49aa; Fragment at the N-terminal, provide the extracellular domain. The amino acid sequence is listed below: MEEPGAQCAP PLAAGSQIAV PQANLSAAHS HNCSAEGYIY QDSIALPWK. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 1B (HTR1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
