Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Annexin A4 (ANXA4) Recombinant Protein | ANXA4 recombinant protein

Recombinant Bovine Annexin A4 (ANXA4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Annexin A4 (ANXA4); Recombinant Bovine Annexin A4 (ANXA4); ANXA4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-319, Full length protein
Sequence
AAKGGTVKAASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQELRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD
Sequence Length
318
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ANXA4 recombinant protein
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,889 Da
NCBI Official Full Name
annexin A4
NCBI Official Synonym Full Names
annexin A4
NCBI Official Symbol
ANXA4
NCBI Protein Information
annexin A4
UniProt Protein Name
Annexin A4
Protein Family
UniProt Gene Name
ANXA4
UniProt Synonym Gene Names
ANX4; PAP-II

Uniprot Description

May play a role in alveolar type II cells through interaction with the surfactant protein SFTPA1 (SP-A).

Research Articles on ANXA4

Similar Products

Product Notes

The ANXA4 anxa4 (Catalog #AAA949369) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-319, Full length protein. The amino acid sequence is listed below: AAKGGTVKAA SGFNAAEDAQ TLRKAMKGLG TDEDAIINVL AYRSTAQRQE IRTAYKTTIG RDLMDDLKSE LSGNFEQVIL GMMTPTVLYD VQELRKAMKG AGTDEGCLIE ILASRTPEEI RRINQTYQLQ YGRSLEDDIR SDTSFMFQRV LVSLSAGGRD ESNYLDDALM RQDAQDLYEA GEKKWGTDEV KFLTVLCSRN RNHLLHVFDE YKRIAQKDIE QSIKSETSGS FEDALLAIVK CMRNKSAYFA ERLYKSMKGL GTDDDTLIRV MVSRAEIDML DIRANFKRLY GKSLYSFIKG DTSGDYRKVL LILCGGDD. It is sometimes possible for the material contained within the vial of "Annexin A4 (ANXA4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.