SDS-PAGE
E-selectin Recombinant Protein | SELE recombinant protein
Recombinant Pig E-selectin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E-selectin; Recombinant Pig E-selectin; CD62 antigen-like family member E; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD62E; SELE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-429. Partial, provide the complete extracellular domain.
Sequence
WSYSASTETMTFDDASAYCQQRYTHLVAIQNHAEIEYLNSTFNYSASYYWIGIRKINGTWTWIGTKKALTPEATNWAPGEPNNKQSNEDCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSGHGECIETINSSTCQCYPGFRGLQCEQVVECDALENPVNGVVTCPQSLPWNTTCAFECKEGFELIGPEHLQCTSSGSWDGKKPTCKAVTCDTVGHPQNGDVSCNHSSIGEFAYKSTCHFTCAEGFGLQGPAQIECTAQGQWTQQAPVCKAVKCPAVSQPKNGLVKFTHSPTGEFTYKSSCAFSCEEGFELRGSAQLACTSQGQWTQEVPSCQVVQCSSLEVPREINMSCSGEPVFGAVCTFACPEGWMLNGSVALTCGATGHWSGMLPTCEAPAESKIP
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for SELE recombinant protein
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
References
Molecular and functional analysis of porcine E-selectin reveals a potential role in xenograft rejection.Rollins S.A., Evans M.J., Johnson K.K., Elliot E.A., Squinto S.P., Matis L.A., Rother R.P.Biochem. Biophys. Res. Commun. 204:763-771(1994)
Cloning and expression kinetics of porcine vascular cell adhesion molecule.Tsang Y.T.M., Haskard D.O., Robinson M.K.Biochem. Biophys. Res. Commun. 201:805-812(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46.3 kDa
NCBI Official Full Name
E-selectin
NCBI Official Symbol
SELE
NCBI Protein Information
E-selectin
UniProt Protein Name
E-selectin
Protein Family
UniProt Gene Name
SELE
UniProt Synonym Gene Names
ELAM-1; LECAM2
UniProt Entry Name
LYAM2_PIG
Uniprot Description
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
Research Articles on SELE
Similar Products
Product Notes
The SELE sele (Catalog #AAA948827) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-429. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: WSYSASTETM TFDDASAYCQ QRYTHLVAIQ NHAEIEYLNS TFNYSASYYW IGIRKINGTW TWIGTKKALT PEATNWAPGE PNNKQSNEDC VEIYIKRDKD SGKWNDERCS KKKLALCYTA ACTPTSCSGH GECIETINSS TCQCYPGFRG LQCEQVVECD ALENPVNGVV TCPQSLPWNT TCAFECKEGF ELIGPEHLQC TSSGSWDGKK PTCKAVTCDT VGHPQNGDVS CNHSSIGEFA YKSTCHFTCA EGFGLQGPAQ IECTAQGQWT QQAPVCKAVK CPAVSQPKNG LVKFTHSPTG EFTYKSSCAF SCEEGFELRG SAQLACTSQG QWTQEVPSCQ VVQCSSLEVP REINMSCSGE PVFGAVCTFA CPEGWMLNGS VALTCGATGH WSGMLPTCEA PAESKIP . It is sometimes possible for the material contained within the vial of "E-selectin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
