Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse liver, using PYCRL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit anti-Mouse PYCRL Polyclonal Antibody | anti-PYCRL antibody

PYCRL Rabbit pAb

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
PYCRL; Polyclonal Antibody; PYCRL Rabbit pAb; anti-PYCRL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK
Applicable Applications for anti-PYCRL antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 13-286 of human PYCRL (NP_075566.2).
Positive Samples
Mouse liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse liver, using PYCRL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse liver, using PYCRL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-PYCRL antibody
Background: This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine. [provided by RefSeq, Aug 2016]
Product Categories/Family for anti-PYCRL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,440 Da
NCBI Official Full Name
pyrroline-5-carboxylate reductase 3
NCBI Official Synonym Full Names
pyrroline-5-carboxylate reductase-like
NCBI Official Symbol
PYCRL
NCBI Protein Information
pyrroline-5-carboxylate reductase 3; P5C reductase 3; P5CR 3; pyrroline-5-carboxylate reductase-like protein
UniProt Protein Name
Pyrroline-5-carboxylate reductase 3
UniProt Gene Name
PYCRL
UniProt Synonym Gene Names
P5C reductase 3; P5CR 3
UniProt Entry Name
P5CR3_HUMAN

Uniprot Description

PYCRL: Belongs to the pyrroline-5-carboxylate reductase family.

Protein type: EC 1.5.1.2; Oxidoreductase; Amino Acid Metabolism - arginine and proline; Hydrolase

Chromosomal Location of Human Ortholog: 8q24.3

Molecular Function: pyrroline-5-carboxylate reductase activity

Similar Products

Product Notes

The PYCRL pycrl (Catalog #AAA9142999) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PYCRL Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PYCRL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PYCRL pycrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAAEPSPRR VGFVGAGRMA GAIAQGLIRA GKVEAQHILA SAPTDRNLCH FQALGCRTTH SNQEVLQSCL LVIFATKPHV LPAVLAEVAP VVTTEHILVS VAAGVSLSTL EELLPPNTRV LRVLPNLPCV VQEGAIVMAR GRHVGSSETK LLQHLLEACG RCEEVPEAYV DIHTGLSGSG VAFVCAFSEA LAEGAVKMGM PSSLAHRIAA QTLLGTAKML LHEGQHPAQL RSDVCTPGGT TIYGLHALEQ GGLRAATMSA VEAATCRAKE LSRK. It is sometimes possible for the material contained within the vial of "PYCRL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.