Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using Olig1 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Rabbit anti-Mouse, Rat Olig1 Polyclonal Antibody | anti-Olig1 antibody

Olig1 Rabbit pAb

Gene Names
OLIG1; BHLHB6; BHLHE21
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
Olig1; Polyclonal Antibody; Olig1 Rabbit pAb; OLIG1; BHLHB6; BHLHE21; anti-Olig1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKE
Applicable Applications for anti-Olig1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Olig1 (NP_620450.2).
Positive Samples
Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using Olig1 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using Olig1 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 30 kDa

Observed: 29 kDa
NCBI Official Full Name
oligodendrocyte transcription factor 1
NCBI Official Synonym Full Names
oligodendrocyte transcription factor 1
NCBI Official Symbol
OLIG1
NCBI Official Synonym Symbols
BHLHB6; BHLHE21
NCBI Protein Information
oligodendrocyte transcription factor 1; oligo1; class B basic helix-loop-helix protein 6; class E basic helix-loop-helix protein 21; oligodendrocyte lineage transcription factor 1; basic domain, helix-loop-helix protein, class B, 6; oligodendrocyte-specif
UniProt Protein Name
Oligodendrocyte transcription factor 1
UniProt Gene Name
OLIG1
UniProt Synonym Gene Names
BHLHB6; BHLHE21; Oligo1; bHLHb6; bHLHe21
UniProt Entry Name
OLIG1_HUMAN

Uniprot Description

OLIG1: Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.

Protein type: Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: nucleus

Molecular Function: protein dimerization activity; protein binding; DNA binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; neuron fate commitment

Research Articles on Olig1

Similar Products

Product Notes

The Olig1 olig1 (Catalog #AAA9142683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Olig1 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Olig1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the Olig1 olig1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYYAVSQARV NAVPGTMLRP QRPGDLQLGA SLYELVGYRQ PPSSSSSSTS STSSTSSSST TAPLLPKAAR EKPEAPAEPP GPGPGSGAHP GGSARPDAKE. It is sometimes possible for the material contained within the vial of "Olig1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.