Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ALG9 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Rabbit anti-Human ALG9 Polyclonal Antibody | anti-ALG9 antibody
ALG9 Rabbit pAb
Gene Names
ALG9; CDG1L; DIBD1; LOH11CR1J
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
ALG9; Polyclonal Antibody; ALG9 Rabbit pAb; CDG1L; DIBD1; GIKANIS; LOH11CR1J; alpha-1; anti-ALG9 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPRKAKQIRKKSGG
Applicable Applications for anti-ALG9 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 439-618 of human ALG9 (NP_079016.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ALG9 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ALG9 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Related Product Information for anti-ALG9 antibody
Background: This gene encodes an alpha-1, 2-mannosyltransferase enzyme that functions in lipid-linked oligosaccharide assembly. Mutations in this gene result in congenital disorder of glycosylation type Il. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
69,863 Da
NCBI Official Full Name
alpha-1,2-mannosyltransferase ALG9 isoform b
NCBI Official Synonym Full Names
ALG9, alpha-1,2-mannosyltransferase
NCBI Official Symbol
ALG9
NCBI Official Synonym Symbols
CDG1L; DIBD1; LOH11CR1J
NCBI Protein Information
alpha-1,2-mannosyltransferase ALG9; disrupted in bipolar disorder protein 1; disrupted in bipolar affective disorder 1; asparagine-linked glycosylation protein 9 homolog; dol-P-Man dependent alpha-1,2-mannosyltransferase; dol-P-Man:Man(6)GlcNAc(2)-PP-Dol
UniProt Protein Name
Alpha-1,2-mannosyltransferase ALG9
Protein Family
UniProt Gene Name
ALG9
UniProt Synonym Gene Names
DIBD1
UniProt Entry Name
ALG9_HUMAN
Similar Products
Product Notes
The ALG9 alg9 (Catalog #AAA9142664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALG9 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALG9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ALG9 alg9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LFRGYHGPLD LYPEFYRIAT DPTIHTVPEG RPVNVCVGKE WYRFPSSFLL PDNWQLQFIP SEFRGQLPKP FAEGPLATRI VPTDMNDQNL EEPSRYIDIS KCHYLVDLDT MRETPREPKY SSNKEEWISL AYRPFLDASR SSKLLRAFYV PFLSDQYTVY VNYTILKPRK AKQIRKKSGG. It is sometimes possible for the material contained within the vial of "ALG9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
