Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse pancreas, using GRINA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit GRINA Polyclonal Antibody | anti-GRINA antibody

GRINA Rabbit pAb

Gene Names
GRINA; LFG1; HNRGW; TMBIM3; NMDARA1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
GRINA; Polyclonal Antibody; GRINA Rabbit pAb; HNRGW; LFG1; NMDARA1; TMBIM3; anti-GRINA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGYP
Applicable Applications for anti-GRINA antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GRINA (NP_000828.1).
Cellular Location
Membrane, Multi-pass membrane protein
Positive Samples
Mouse pancreas
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse pancreas, using GRINA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse pancreas, using GRINA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 41 kDa
NCBI Official Full Name
protein lifeguard 1
NCBI Official Synonym Full Names
glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding)
NCBI Official Symbol
GRINA
NCBI Official Synonym Symbols
LFG1; HNRGW; TMBIM3; NMDARA1
NCBI Protein Information
protein lifeguard 1; putative MAPK-activating protein PM02; NMDA receptor glutamate-binding subunit; glutamate [NMDA] receptor-associated protein 1; transmembrane BAX inhibitor motif containing 3; transmembrane BAX inhibitor motif-containing protein 3; gl
UniProt Protein Name
Protein lifeguard 1
Protein Family
UniProt Gene Name
GRINA
UniProt Synonym Gene Names
LFG1; NMDARA1; TMBIM3
UniProt Entry Name
LFG1_HUMAN

Uniprot Description

NMDARA1: Potential apoptotic regulator. Belongs to the BI1 family. LFG subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: Golgi apparatus; endoplasmic reticulum; integral to membrane

Biological Process: endoplasmic reticulum calcium ion homeostasis

Research Articles on GRINA

Similar Products

Product Notes

The GRINA grina (Catalog #AAA9142298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRINA Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRINA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the GRINA grina for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSHEKSFLVS GDNYPPPNPG YPGGPQPPMP PYAQPPYPGA PYPQPPFQPS PYGQPGYPHG PSPYPQGGYP QGPYPQGGYP QGPYPQEGYP QGPYPQGGYP. It is sometimes possible for the material contained within the vial of "GRINA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.