Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Jurkat cells, using FYB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit anti-Human, Mouse FYB Polyclonal Antibody | anti-FYB antibody

FYB Rabbit pAb

Gene Names
FYB; ADAP; PRO0823; SLAP130; SLAP-130
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
FYB; Polyclonal Antibody; FYB Rabbit pAb; ADAP; PRO0823; SLAP-130; SLAP130; THC3; anti-FYB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NEGSSFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEIYDDIADGCIYDND
Applicable Applications for anti-FYB antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 678-829 of human FYB (NP_001456.3).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
Jurkat, Mouse spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Jurkat cells, using FYB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of Jurkat cells, using FYB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB)

(Western blot analysis of extracts of Mouse spleen, using FYB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse spleen, using FYB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-FYB antibody
Background: The protein encoded by this gene is an adapter for the FYN protein and LCP2 signaling cascades in T-cells. The encoded protein is involved in platelet activation and controls the expression of interleukin-2. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-FYB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91,651 Da
NCBI Official Full Name
FYN-binding protein isoform 1
NCBI Official Synonym Full Names
FYN binding protein
NCBI Official Symbol
FYB
NCBI Official Synonym Symbols
ADAP; PRO0823; SLAP130; SLAP-130
NCBI Protein Information
FYN-binding protein; p120/p130; FYB-120/130; FYN-T-binding protein; SLP-76-associated phosphoprotein; adhesion and degranulation-promoting adaptor protein
UniProt Protein Name
FYN-binding protein
Protein Family
UniProt Gene Name
FYB
UniProt Synonym Gene Names
SLAP130; ADAP; p120/p130
UniProt Entry Name
FYB_HUMAN

NCBI Description

The protein encoded by this gene is an adapter for the FYN protein and LCP2 signaling cascades in T-cells. The encoded protein is involved in platelet activation and controls the expression of interleukin-2. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

Uniprot Description

SLAP-130: an adapter protein for fyn and the SH2-domain-containing leucocyte protein-76 (SLP76) in T cells. T-cell receptor ligation leads to increased tyrosine phosphorylation of SLAP-130. Two alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 5p13.1

Cellular Component: cytosol; nucleus; actin cytoskeleton

Molecular Function: protein binding; protein complex binding; receptor binding

Biological Process: immune response; NLS-bearing substrate import into nucleus; signal transduction; T cell receptor signaling pathway; protein amino acid phosphorylation

Research Articles on FYB

Similar Products

Product Notes

The FYB fyb (Catalog #AAA9142143) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FYB Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FYB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the FYB fyb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NEGSSFPAPP KQLDMGDEVY DDVDTSDFPV SSAEMSQGTN VGKAKTEEKD LKKLKKQEKE EKDFRKKFKY DGEIRVLYST KVTTSITSKK WGTRDLQVKP GESLEVIQTT DDTKVLCRNE EGKYGYVLRS YLADNDGEIY DDIADGCIYD ND. It is sometimes possible for the material contained within the vial of "FYB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.