Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human MAPK1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 66 kDa.)

MAPK1 recombinant protein

Recombinant Human MAPK1 Protein

Gene Names
MAPK1; ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
Purity
>70% by SDS-PAGE.
Synonyms
MAPK1; Recombinant Human MAPK1 Protein; ERK; ERK-2; ERK2; ERT1; MAPK2; p38; p40; p41; p41mapk; p42-MAPK; P42MAPK; PRKM1; PRKM2; MAPK1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>70% by SDS-PAGE.
Form/Format
Supplied in 50mM Tris, 150mM NaCl, 0.1mM EDTA, 0.25mM DTT, 0.1mM AEBSF, 25%glycerol, 10mM GSH, pH 8.0.
Sequence
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Sequence Length
360
Species
Human
Endotoxin
Please contact us for more information.
Tag
GST tag at the N-terminus
Preparation and Storage
This product is stable at <= -70 degree C for up to 1 year from the date of receipt.
For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Avoid repeated freeze-thaw cycles.

SDS-Page

(Recombinant Human MAPK1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 66 kDa.)

SDS-Page (Recombinant Human MAPK1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 66 kDa.)
Related Product Information for MAPK1 recombinant protein
Description: Recombinant Human MAPK1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser360) of human MAPK1 (Accession #NP_002736.3) fused with a GST tag at the N-terminus.

Background: ERK2 is a protein serine/threonine kinase, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions.
Product Categories/Family for MAPK1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mitogen-activated protein kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 1
NCBI Official Symbol
MAPK1
NCBI Official Synonym Symbols
ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
NCBI Protein Information
mitogen-activated protein kinase 1
UniProt Protein Name
Mitogen-activated protein kinase 1
UniProt Gene Name
MAPK1
UniProt Synonym Gene Names
ERK2; PRKM1; PRKM2; MAP kinase 1; MAPK 1; ERK-2; p42-MAPK; MAP kinase 2; MAPK 2
UniProt Entry Name
MK01_HUMAN

NCBI Description

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

Uniprot Description

ERK2: a serine/threonine kinase of the GMGC group that plays a critical role in the regulation of cell growth and differentiation. ERK1 (MAPK3) and ERK2 (MAPK1) play central roles in MAPK cascades and are activated by a wide variety of extracellular signals including growth and neurotrophic factors, cytokines, hormones and neurotransmitters. Depending on the cellular context, MAPK cascades mediate diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. MAPK cascades also plays a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. Activation of MAP kinases occurs through phosphorylation of threonine and tyrosine residues at the sequence T*EY* by upstream MAP kinase kinases, MEK1 and -2. Phosphorylation of both the threonine and tyrosine are required for activity. This phosphorylation causes dramatic conformational changes, which enable full activation and interaction of MAPK1/ERK2 with its substrates.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CMGC; EC 2.7.11.24; CMGC group; MAPK family; MAPK/ERK subfamily; ERK subfamily

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: dendrite cytoplasm; Golgi apparatus; protein complex; focal adhesion; mitochondrion; early endosome; perikaryon; pseudopodium; caveola; cytosol; nucleoplasm; microtubule cytoskeleton; cytoskeleton; axon; late endosome; cytoplasm; microtubule organizing center; nucleus

Molecular Function: RNA polymerase subunit kinase activity; MAP kinase activity; protein serine/threonine kinase activity; protein binding; DNA binding; phosphotyrosine binding; mitogen-activated protein kinase kinase kinase binding; transcription factor binding; ATP binding; phosphatase binding

Biological Process: nerve growth factor receptor signaling pathway; activation of MAPKK activity; viral reproduction; activation of MAPK activity; positive regulation of transcription, DNA-dependent; response to toxin; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; sensory perception of pain; protein amino acid phosphorylation; T cell receptor signaling pathway; toll-like receptor 5 signaling pathway; B cell receptor signaling pathway; regulation of transcription factor activity; small GTPase mediated signal transduction; toll-like receptor 4 signaling pathway; platelet activation; fibroblast growth factor receptor signaling pathway; transcription, DNA-dependent; toll-like receptor 2 signaling pathway; regulation of stress-activated MAPK cascade; nuclear translocation of MAPK; organ morphogenesis; response to estrogen stimulus; toll-like receptor 9 signaling pathway; regulation of cytoskeleton organization and biogenesis; axon guidance; positive regulation of translation; apoptosis; regulation of protein stability; chemotaxis; signal transduction; toll-like receptor 10 signaling pathway; synaptic transmission; response to exogenous dsRNA; positive regulation of cell proliferation; lipopolysaccharide-mediated signaling pathway; response to stress; epidermal growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; peptidyl-threonine phosphorylation; MAPKKK cascade; mammary gland epithelial cell proliferation; cell cycle; MyD88-dependent toll-like receptor signaling pathway; negative regulation of cell differentiation; peptidyl-serine phosphorylation; cytosine metabolic process; Ras protein signal transduction; insulin receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; blood coagulation; vascular endothelial growth factor receptor signaling pathway; response to DNA damage stimulus; positive regulation of cell migration

Research Articles on MAPK1

Similar Products

Product Notes

The MAPK1 mapk1 (Catalog #AAA9141750) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MAAAAAAGAG PEMVRGQVFD VGPRYTNLSY IGEGAYGMVC SAYDNVNKVR VAIKKISPFE HQTYCQRTLR EIKILLRFRH ENIIGINDII RAPTIEQMKD VYIVQDLMET DLYKLLKTQH LSNDHICYFL YQILRGLKYI HSANVLHRDL KPSNLLLNTT CDLKICDFGL ARVADPDHDH TGFLTEYVAT RWYRAPEIML NSKGYTKSID IWSVGCILAE MLSNRPIFPG KHYLDQLNHI LGILGSPSQE DLNCIINLKA RNYLLSLPHK NKVPWNRLFP NADSKALDLL DKMLTFNPHK RIEVEQALAH PYLEQYYDPS DEPIAEAPFK FDMELDDLPK EKLKELIFEE TARFQPGYRS. It is sometimes possible for the material contained within the vial of "MAPK1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.