Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human E-Selectin/CD62E Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 110-120 kDa.)

E-Selectin/CD62E Active Protein | CD62E active protein

Recombinant Human E-Selectin/CD62E Protein

Gene Names
SELE; ELAM; ESEL; CD62E; ELAM1; LECAM2
Purity
>97% by SDS-PAGE.
Synonyms
E-Selectin/CD62E; Recombinant Human E-Selectin/CD62E Protein; CD62E; ELAM; ELAM1; ESEL; LECAM2; CD62E active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
Sequence Length
610
Species
Human
Endotoxin
Please contact us for more information.
Biological Activity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When cells are added to E-selectin coated plates (2 ug/mL, 100 uL/well) approximately > 60% will adhere specifically.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human E-Selectin/CD62E Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 110-120 kDa.)

SDS-Page (Recombinant Human E-Selectin/CD62E Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 110-120 kDa.)
Related Product Information for CD62E active protein
Description: Recombinant Human E-Selectin/CD62E Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp22-Pro556) of human E-Selectin/CD62E (Accession #NP_000441.2) fused with a 6xHis tag at the C-terminus.

Background: The protein is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.
Product Categories/Family for CD62E active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E-selectin
NCBI Official Synonym Full Names
selectin E
NCBI Official Symbol
SELE
NCBI Official Synonym Symbols
ELAM; ESEL; CD62E; ELAM1; LECAM2
NCBI Protein Information
E-selectin
UniProt Protein Name
E-selectin
UniProt Gene Name
SELE
UniProt Synonym Gene Names
ELAM1; ELAM-1; LECAM2
UniProt Entry Name
LYAM2_HUMAN

NCBI Description

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

SELE: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis. Belongs to the selectin/LECAM family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q22-q25

Cellular Component: cortical cytoskeleton; extracellular space; perinuclear region of cytoplasm; integral to membrane; plasma membrane; coated pit; caveola; lipid raft

Molecular Function: protein binding; phospholipase binding; transmembrane receptor activity; sialic acid binding

Biological Process: heterophilic cell adhesion; leukocyte adhesion; phospholipase C activation; positive regulation of leukocyte migration; actin filament-based process; positive regulation of receptor internalization; regulation of inflammatory response; calcium-mediated signaling; response to lipopolysaccharide; blood coagulation; leukocyte tethering or rolling; inflammatory response; leukocyte migration; leukocyte migration during inflammatory response

Disease: Hypertension, Essential

Research Articles on CD62E

Similar Products

Product Notes

The CD62E sele (Catalog #AAA9141742) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: WSYNTSTEAM TYDEASAYCQ QRYTHLVAIQ NKEEIEYLNS ILSYSPSYYW IGIRKVNNVW VWVGTQKPLT EEAKNWAPGE PNNRQKDEDC VEIYIKREKD VGMWNDERCS KKKLALCYTA ACTNTSCSGH GECVETINNY TCKCDPGFSG LKCEQIVNCT ALESPEHGSL VCSHPLGNFS YNSSCSISCD RGYLPSSMET MQCMSSGEWS APIPACNVVE CDAVTNPANG FVECFQNPGS FPWNTTCTFD CEEGFELMGA QSLQCTSSGN WDNEKPTCKA VTCRAVRQPQ NGSVRCSHSP AGEFTFKSSC NFTCEEGFML QGPAQVECTT QGQWTQQIPV CEAFQCTALS NPERGYMNCL PSASGSFRYG SSCEFSCEQG FVLKGSKRLQ CGPTGEWDNE KPTCEAVRCD AVHQPPKGLV RCAHSPIGEF TYKSSCAFSC EEGFELHGST QLECTSQGQW TEEVPSCQVV KCSSLAVPGK INMSCSGEPV FGTVCKFACP EGWTLNGSAA RTCGATGHWS GLLPTCEAPT ESNIP. It is sometimes possible for the material contained within the vial of "E-Selectin/CD62E, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.