Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-DYNLT3 Polyclonal Antibody)

Rabbit anti-Human, Mouse DYNLT3 Polyclonal Antibody | anti-DYNLT3 antibody

DYNLT3 Polyclonal Antibody

Gene Names
DYNLT3; RP3; TCTE1L; TCTEX1L
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DYNLT3; Polyclonal Antibody; DYNLT3 Polyclonal Antibody; RP3; TCTE1L; TCTEX1L; dynein light chain Tctex-type 3; anti-DYNLT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
4.03 mg/ml (varies by lot)
Sequence Length
116
Applicable Applications for anti-DYNLT3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 9-99 of human DYNLT3 (NP_006511.1).
Immunogen Sequence
DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-DYNLT3 Polyclonal Antibody)

Western Blot (WB) (Western blot-DYNLT3 Polyclonal Antibody)
Related Product Information for anti-DYNLT3 antibody
This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
dynein light chain Tctex-type 3
NCBI Official Synonym Full Names
dynein light chain Tctex-type 3
NCBI Official Symbol
DYNLT3
NCBI Official Synonym Symbols
RP3; TCTE1L; TCTEX1L
NCBI Protein Information
dynein light chain Tctex-type 3
UniProt Protein Name
Dynein light chain Tctex-type 3
Protein Family
UniProt Gene Name
DYNLT3
UniProt Synonym Gene Names
TCTE1L; TCTE1XL
UniProt Entry Name
DYLT3_HUMAN

NCBI Description

This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.[provided by RefSeq, Mar 2010]

Uniprot Description

DYNLT3: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis. Belongs to the dynein light chain Tctex-type family.

Protein type: Motor; Microtubule-binding

Chromosomal Location of Human Ortholog: Xp21

Cellular Component: kinetochore; microtubule; cytoplasmic dynein complex; nucleus

Molecular Function: identical protein binding; motor activity

Biological Process: mitosis; cell division; metabolic process; transport; regulation of mitotic cell cycle

Research Articles on DYNLT3

Similar Products

Product Notes

The DYNLT3 dynlt3 (Catalog #AAA9141020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYNLT3 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DYNLT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DYNLT3 dynlt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DYNLT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.