Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SLC25A31 Polyclonal Antibody)

Rabbit anti-Mouse, Rat SLC25A31 Polyclonal Antibody | anti-SLC25A31 antibody

SLC25A31 Polyclonal Antibody

Gene Names
SLC25A31; AAC4; ANT4; ANT 4; SFEC35kDa
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SLC25A31; Polyclonal Antibody; SLC25A31 Polyclonal Antibody; AAC4; ANT 4; ANT4; SFEC35kDa; ADP/ATP translocase 4; anti-SLC25A31 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.73 mg/ml (varies by lot)
Sequence Length
315
Applicable Applications for anti-SLC25A31 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A31 (NP_112581.1).
Immunogen Sequence
NFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYR
Positive Samples
Mouse Testis, Rat Testis
Cellular Location
Cell Projection, Mitochondrion Inner Membrane, Multi-Pass Membrane Protein, Cilium, Flagellum
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SLC25A31 Polyclonal Antibody)

Western Blot (WB) (Western blot-SLC25A31 Polyclonal Antibody)
Related Product Information for anti-SLC25A31 antibody
The protein encoded by this gene is a member of the ADP/ATP carrier family of proteins that exchange cytosolic ADP for matrix ATP in the mitochondria. Cells over-expressing this gene have been shown to display an anti-apoptotic phenotype. This protein is also thought to play a role in spermatogenesis, where it is believed to associate with a part of the flagellar cytoskeleton and with glycolytic enzymes. Male mice with mutations in the mouse ortholog of this gene are sterile and spermatocytes display an early meiotic arrest phenotype. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 35kDa
Observed: 35kDa
NCBI Official Full Name
ADP/ATP translocase 4 isoform 1
NCBI Official Synonym Full Names
solute carrier family 25 member 31
NCBI Official Symbol
SLC25A31
NCBI Official Synonym Symbols
AAC4; ANT4; ANT 4; SFEC35kDa
NCBI Protein Information
ADP/ATP translocase 4
UniProt Protein Name
ADP/ATP translocase 4
Protein Family
UniProt Gene Name
SLC25A31
UniProt Synonym Gene Names
AAC4; ANT4; SFEC; ANT 4
UniProt Entry Name
ADT4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the ADP/ATP carrier family of proteins that exchange cytosolic ADP for matrix ATP in the mitochondria. Cells over-expressing this gene have been shown to display an anti-apoptotic phenotype. This protein is also thought to play a role in spermatogenesis, where it is believed to associate with a part of the flagellar cytoskeleton and with glycolytic enzymes. Male mice with mutations in the mouse ortholog of this gene are sterile and spermatocytes display an early meiotic arrest phenotype. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]

Uniprot Description

SLC25A31: Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. May serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility. Belongs to the mitochondrial carrier family.

Protein type: Mitochondrial; Transporter; Membrane protein, integral; Transporter, SLC family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 4q28.1

Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane; nucleus

Molecular Function: transporter activity

Biological Process: transmembrane transport

Research Articles on SLC25A31

Similar Products

Product Notes

The SLC25A31 slc25a31 (Catalog #AAA9140925) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A31 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SLC25A31 slc25a31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.