Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SMURF1 Polyclonal Antibody)

Rabbit anti-Human SMURF1 Polyclonal Antibody | anti-SMURF1 antibody

SMURF1 Polyclonal Antibody

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SMURF1; Polyclonal Antibody; SMURF1 Polyclonal Antibody; E3 ubiquitin-protein ligase SMURF1; anti-SMURF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.11 mg/ml (varies by lot)
Sequence Length
728
Applicable Applications for anti-SMURF1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SMURF1 (NP_001186776.1).
Immunogen Sequence
VDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQV
Positive Samples
HeLa, U-87MG, MCF7
Cellular Location
Cell Membrane, Cytoplasm, Cytoplasmic Side, Peripheral Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SMURF1 Polyclonal Antibody)

Western Blot (WB) (Western blot-SMURF1 Polyclonal Antibody)
Related Product Information for anti-SMURF1 antibody
This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. This protein plays a key roll in the regulation of cell motility, cell signalling, and cell polarity. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 83kDa; 86kDa
Observed: 100kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase SMURF1 isoform 3
NCBI Official Synonym Full Names
SMAD specific E3 ubiquitin protein ligase 1
NCBI Official Symbol
SMURF1
NCBI Protein Information
E3 ubiquitin-protein ligase SMURF1
UniProt Protein Name
E3 ubiquitin-protein ligase SMURF1
UniProt Gene Name
SMURF1
UniProt Synonym Gene Names
KIAA1625; hSMURF1
UniProt Entry Name
SMUF1_HUMAN

NCBI Description

This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. This protein plays a key roll in the regulation of cell motility, cell signalling, and cell polarity. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Dec 2010]

Uniprot Description

SMURF1: E3 ubiquitin-protein ligase that acts as a negative regulator of BMP signaling pathway. Mediates ubiquitination and degradation of SMAD1 and SMAD5, 2 receptor-regulated SMADs specific for the BMP pathway. Promotes ubiquitination and subsequent proteasomal degradation of TRAF family members and RHOA. Interacts with TRAF4. Interacts (via HECT domain) with FBXL15 (via LRR repeats). Interacts with SMAD7 and TGFBR1; SMAD7 recruits SMURF1 to TGFBR1 and regulates TGF-beta receptor degradation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.19; Ubiquitin conjugating system; EC 6.3.2.-; Ligase; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: axon; cell soma; cytoplasm; cytosol; mitochondrion; nucleoplasm; nucleus; plasma membrane

Molecular Function: activin binding; ligase activity; phospholipid binding; protein binding; ubiquitin-protein ligase activity

Biological Process: BMP signaling pathway; cell differentiation; ectoderm development; negative regulation of BMP signaling pathway; negative regulation of ossification; negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of defense response to virus by host; proteasomal ubiquitin-dependent protein catabolic process; protein export from nucleus; protein polyubiquitination; protein ubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; receptor catabolic process; transforming growth factor beta receptor signaling pathway; ubiquitin-dependent SMAD protein catabolic process; Wnt receptor signaling pathway, planar cell polarity pathway

Research Articles on SMURF1

Similar Products

Product Notes

The SMURF1 smurf1 (Catalog #AAA9140913) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMURF1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMURF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SMURF1 smurf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMURF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.