Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-DGKZ Polyclonal Antibody)

Rabbit anti-Human, Mouse DGKZ Polyclonal Antibody | anti-DGKZ antibody

DGKZ Polyclonal Antibody

Gene Names
DGKZ; DAGK5; DAGK6; DGK-ZETA; hDGKzeta
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DGKZ; Polyclonal Antibody; DGKZ Polyclonal Antibody; DAGK5; DAGK6; DGK-ZETA; hDGKzeta; diacylglycerol kinase zeta; anti-DGKZ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.25 mg/ml (varies by lot)
Sequence Length
1117
Applicable Applications for anti-DGKZ antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 808-1117 of human DGKZ (NP_001099010.1).
Immunogen Sequence
ATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV
Positive Samples
LO2, HeLa, 293T, Mouse Brain
Cellular Location
Cell Membrane, Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-DGKZ Polyclonal Antibody)

Western Blot (WB) (Western blot-DGKZ Polyclonal Antibody)
Related Product Information for anti-DGKZ antibody
The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 101kDa; 103kDa; 104kDa; 106kDa; 124kDa
Observed: 120kDa
NCBI Official Full Name
diacylglycerol kinase zeta isoform 4
NCBI Official Synonym Full Names
diacylglycerol kinase zeta
NCBI Official Symbol
DGKZ
NCBI Official Synonym Symbols
DAGK5; DAGK6; DGK-ZETA; hDGKzeta
NCBI Protein Information
diacylglycerol kinase zeta
UniProt Protein Name
Diacylglycerol kinase zeta
Protein Family
UniProt Gene Name
DGKZ
UniProt Synonym Gene Names
DAGK6; DAG kinase zeta; DGK-zeta
UniProt Entry Name
DGKZ_HUMAN

NCBI Description

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2010]

Uniprot Description

DGKZ: Displays a strong preference for 1,2-diacylglycerols over 1,3-diacylglycerols, but lacks substrate specificity among molecular species of long chain diacylglycerols. Isoform 2 but not isoform 1 regulates RASGRP1 activity. Belongs to the eukaryotic diacylglycerol kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Kinase, lipid; Lipid Metabolism - glycerolipid; EC 2.7.1.107; Lipid Metabolism - glycerophospholipid

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: nucleoplasm; lamellipodium; cytoplasm; plasma membrane; nucleus

Molecular Function: enzyme inhibitor activity; protein C-terminus binding; lipid kinase activity; protein binding; metal ion binding; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: G1 DNA damage checkpoint; platelet activation; cell migration; negative regulation of catalytic activity; protein kinase C activation; negative regulation of Ras protein signal transduction; negative regulation of mitotic cell cycle; lipid phosphorylation; blood coagulation; phosphorylation

Research Articles on DGKZ

Similar Products

Product Notes

The DGKZ dgkz (Catalog #AAA9140860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGKZ Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DGKZ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DGKZ dgkz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DGKZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.