Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit S100A16 Polyclonal Antibody | anti-S100A16 antibody

S100A16 Polyclonal Antibody

Gene Names
S100A16; AAG13; S100F; DT1P1A7
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
S100A16; Polyclonal Antibody; S100A16 Polyclonal Antibody; AAG13; DT1P1A7; S100F; protein S100-A16; anti-S100A16 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.15 mg/ml (varies by lot)
Sequence Length
103
Applicable Applications for anti-S100A16 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human S100A16 (NP_525127.1).
Immunogen Sequence
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Positive Samples
U-87MG, Mouse Kidney, Rat Kidney
Cellular Location
Cytoplasm, Nucleus, Nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-S100A16 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 11kDa
Observed: 12kDa
NCBI Official Full Name
protein S100-A16
NCBI Official Synonym Full Names
S100 calcium binding protein A16
NCBI Official Symbol
S100A16
NCBI Official Synonym Symbols
AAG13; S100F; DT1P1A7
NCBI Protein Information
protein S100-A16
UniProt Protein Name
Protein S100-A16
Protein Family
UniProt Gene Name
S100A16
UniProt Synonym Gene Names
S100F
UniProt Entry Name
S10AG_HUMAN

Uniprot Description

S100A16: Calcium-binding protein. Binds one calcium ion per monomer. Belongs to the S-100 family.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytoplasm; nucleolus; plasma membrane; cytosol

Molecular Function: protein homodimerization activity; calcium ion binding

Biological Process: response to calcium ion

Research Articles on S100A16

Similar Products

Product Notes

The S100A16 s100a16 (Catalog #AAA9140761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A16 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's S100A16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the S100A16 s100a16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual