Rabbit anti-Rat TRAF7 Polyclonal Antibody | anti-TRAF7 antibody

TRAF7 Polyclonal Antibody

Cat. Num. AAA9140607

• Gene Names: TRAF7; RFWD1; RNF119; CAFDADD
• Reactivity: Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: TRAF7; Polyclonal Antibody; TRAF7 Polyclonal Antibody; RFWD1; RNF119; TNF receptor associated factor 7; anti-TRAF7 antibody

• Host: Rabbit
• Reactivity: Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 3.3 mg/ml (varies by lot)
• Sequence Length: 670

• Applicable Applications for anti-TRAF7 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 260-400 of human TRAF7 (NP_115647.2).
• Immunogen Sequence: PHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVW
• Positive Samples: Rat Testis, Rat Heart
• Cellular Location: Cytoplasmic Vesicle
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-TRAF7 Polyclonal Antibody)

Related Product Information for anti-TRAF7 antibody

Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding.

NCBI and Uniprot Product Information

• NCBI GI #: 54036486
• NCBI GeneID: 84231
• UniProt Accession #: Q6Q0C0
• Molecular Weight: Calculated: 66kDa; 74kDa; Observed: 75kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase TRAF7
• NCBI Official Synonym Full Names: TNF receptor associated factor 7
• NCBI Official Symbol: TRAF7
• NCBI Official Synonym Symbols: RFWD1; RNF119; CAFDADD
• NCBI Protein Information: E3 ubiquitin-protein ligase TRAF7
• UniProt Protein Name: E3 ubiquitin-protein ligase TRAF7
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: TRAF7
• UniProt Synonym Gene Names: RFWD1; RNF119
• UniProt Entry Name: TRAF7_HUMAN

NCBI Description

Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding.[supplied by OMIM, Apr 2004]

Uniprot Description

TRAF7: E3 ubiquitin ligase capable of auto-ubiquitination, following phosphorylation by MAP3K3. Potentiates MEKK3-mediated activation of the NF-kappa-B, JUN/AP1 and DDIT3 transcriptional regulators. Induces apoptosis when overexpressed. Belongs to the WD repeat TRAF7 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; Ubiquitin ligase; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: intracellular membrane-bound organelle; perinuclear region of cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; nucleus; cytosol; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: positive regulation of protein sumoylation; regulation of protein localization; positive regulation of MAPKKK cascade; transcription, DNA-dependent; apoptosis; activation of MAPKKK activity; protein ubiquitination; negative regulation of transcription from RNA polymerase II promoter