Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-MED31 Polyclonal Antibody)

Rabbit MED31 Polyclonal Antibody | anti-MED31 antibody

MED31 Polyclonal Antibody

Gene Names
MED31; Soh1; CGI-125; 3110004H13Rik
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MED31; Polyclonal Antibody; MED31 Polyclonal Antibody; 3110004H13Rik; CGI-125; Soh1; mediator complex subunit 31; anti-MED31 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.8 mg/ml (varies by lot)
Sequence Length
131
Applicable Applications for anti-MED31 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human MED31 (NP_057144.1).
Immunogen Sequence
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
Positive Samples
U-87MG, Mouse Brain, Mouse Liver, Mouse Testis, Rat Brain
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-MED31 Polyclonal Antibody)

Western Blot (WB) (Western blot-MED31 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 15kDa
Observed: 16kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 31
NCBI Official Synonym Full Names
mediator complex subunit 31
NCBI Official Symbol
MED31
NCBI Official Synonym Symbols
Soh1; CGI-125; 3110004H13Rik
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 31
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 31
UniProt Gene Name
MED31
UniProt Synonym Gene Names
SOH1; CGI-125; hSOH1
UniProt Entry Name
MED31_HUMAN

Research Articles on MED31

Similar Products

Product Notes

The MED31 med31 (Catalog #AAA9140539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MED31 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MED31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MED31 med31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MED31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.