Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Olfactomedin-4/OLFM4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Olfactomedin-4/OLFM4 Recombinant Protein | OLFM4 recombinant protein

Recombinant Human Olfactomedin-4/OLFM4 Protein

Gene Names
OLFM4; GC1; OLM4; OlfD; GW112; hGC-1; hOLfD; UNQ362; bA209J19.1
Purity
>95% by SDS-PAGE.
Synonyms
Olfactomedin-4/OLFM4; Recombinant Human Olfactomedin-4/OLFM4 Protein; Olfactomedin-4; OLM4; Antiapoptotic protein GW112; G-CSF-stimulated clone 1 protein; hGC-1; hOLfD; OLFM4; GW112; OLFM4 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
DLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWG
Sequence Length
510
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Tag
10xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Olfactomedin-4/OLFM4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human Olfactomedin-4/OLFM4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for OLFM4 recombinant protein
Recombinant Human Olfactomedin-4/OLFM4 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Asp21-Gln510) of human Olfactomedin-4/OLFM4 (Accession #Q6UX06) fused with a 10xHis tag at the C-terminus.
Product Categories/Family for OLFM4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
olfactomedin-4
NCBI Official Synonym Full Names
olfactomedin 4
NCBI Official Symbol
OLFM4
NCBI Official Synonym Symbols
GC1; OLM4; OlfD; GW112; hGC-1; hOLfD; UNQ362; bA209J19.1
NCBI Protein Information
olfactomedin-4
UniProt Protein Name
Olfactomedin-4
Protein Family
UniProt Gene Name
OLFM4
UniProt Synonym Gene Names
GW112; OLM4; hGC-1
UniProt Entry Name
OLFM4_HUMAN

NCBI Description

This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth and is an extracellular matrix glycoprotein that facilitates cell adhesion. [provided by RefSeq, Mar 2011]

Uniprot Description

OLFM4: May promote proliferation of pancreatic cancer cells by favoring the transition from the S to G2/M phase. In myeloid leukemic cell lines, inhibits cell growth and induces cell differentiation and apoptosis. May play a role in the inhibition of EIF4EBP1 phosphorylation/deactivation. Facilitates cell adhesion, most probably through interaction with cell surface lectins and cadherin.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: extracellular space; azurophil granule; specific granule; mitochondrion; perinuclear region of cytoplasm; plasma membrane; secretory granule

Molecular Function: protein homodimerization activity; cadherin binding; catalytic activity

Biological Process: regulation of apoptosis; metabolic process; negative regulation of immune response; negative regulation of I-kappaB kinase/NF-kappaB cascade; cell adhesion; regulation of phagocytosis; protein homooligomerization

Research Articles on OLFM4

Similar Products

Product Notes

The OLFM4 olfm4 (Catalog #AAA9140360) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DLGDVGPPIP SPGFSSFPGV DSSSSFSSSS RSGSSSSRSL GSGGSVSQLF SNFTGSVDDR GTCQCSVSLP DTTFPVDRVE RLEFTAHVLS QKFEKELSKV REYVQLISVY EKKLLNLTVR IDIMEKDTIS YTELDFELIK VEVKEMEKLV IQLKESFGGS SEIVDQLEVE IRNMTLLVEK LETLDKNNVL AIRREIVALK TKLKECEASK DQNTPVVHPP PTPGSCGHGG VVNISKPSVV QLNWRGFSYL YGAWG. It is sometimes possible for the material contained within the vial of "Olfactomedin-4/OLFM4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.