Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human G-CSF/CSF1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

G-CSF/CSF1 Active Protein | G-CSF active protein

Recombinant Human G-CSF/CSF1 Protein

Gene Names
CSF3; GCSF; CSF3OS; C17orf33
Purity
>95% by SDS-PAGE.
Synonyms
G-CSF/CSF1; Recombinant Human G-CSF/CSF1 Protein; Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF; G-CSF active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0.
Sequence
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Sequence Length
168
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using a murine myeloblastic cell line, NFS-60. The ED50 for this effect is typically 0.2-0.8 ng/ml.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human G-CSF/CSF1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human G-CSF/CSF1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for G-CSF active protein
Description: Recombinant Human G-CSF/CSF1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr31-Pro204) of human G-CSF/CSF1 (Accession #P09919-2) fused with an initial Met at the N-terminus.

Background: Human Granulocyte-Colony-Stimulating Factor (G-CSF) is 20 kD glycoprotein containing internal disulfidebonds. It induces the survival, proliferation, and differentiation of neutrophilic granulocyte precursor cells andit functionally activates mature blood neutrophils. Among the family of colony-stimulating factors, G-CSF is themost potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid celllines. The synthesis of G-CSF can be induced by bacterial endotoxins, TNF, Interleukin-1, and GM-CSF.Prostaglandin E2 inhibits the synthesis of G-CSF. In epithelial, endothelial, and fibroblastic cells secretion of G-CSF is induced by Interleukin-17.
Product Categories/Family for G-CSF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
granulocyte colony-stimulating factor isoform d
NCBI Official Synonym Full Names
colony stimulating factor 3
NCBI Official Symbol
CSF3
NCBI Official Synonym Symbols
GCSF; CSF3OS; C17orf33
NCBI Protein Information
granulocyte colony-stimulating factor
UniProt Protein Name
Granulocyte colony-stimulating factor
UniProt Gene Name
CSF3
UniProt Synonym Gene Names
C17orf33; GCSF; G-CSF
UniProt Entry Name
CSF3_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]

Uniprot Description

G-CSF: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. Belongs to the IL-6 superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell cycle regulation; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q11.2-q12

Cellular Component: extracellular space

Molecular Function: enzyme binding; growth factor activity; cytokine activity; granulocyte colony-stimulating factor receptor binding

Biological Process: granulocyte differentiation; positive regulation of myeloid cell differentiation; positive regulation of protein binding; multicellular organismal development; cytokine and chemokine mediated signaling pathway; positive regulation of peptidyl-serine phosphorylation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of actin filament polymerization; positive regulation of cell proliferation; positive regulation of transcription factor import into nucleus; immune response; positive regulation of transcription from RNA polymerase II promoter

Research Articles on G-CSF

Similar Products

Product Notes

The G-CSF csf3 (Catalog #AAA9139905) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TPLGPASSLP QSFLLKCLEQ VRKIQGDGAA LQEKLCATYK LCHPEELVLL GHSLGIPWAP LSSCPSQALQ LAGCLSQLHS GLFLYQGLLQ ALEGISPELG PTLDTLQLDV ADFATTIWQQ MEELGMAPAL QPTQGAMPAF ASAFQRRAGG VLVASHLQSF LEVSYRVLRH LAQP. It is sometimes possible for the material contained within the vial of "G-CSF/CSF1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.