Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Mouse, Rat ADGRA3 Polyclonal Antibody | anti-ADGRA3 antibody

ADGRA3 Polyclonal Antibody

Gene Names
ADGRA3; PGR21; TEM5L; GPR125
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ADGRA3; Polyclonal Antibody; ADGRA3 Polyclonal Antibody; GPR125; PGR21; TEM5L; anti-ADGRA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL
Sequence Length
1321
Applicable Applications for anti-ADGRA3 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human ADGRA3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-ADGRA3 antibody
This gene encodes a member of the G protein-coupled receptor superfamily. This membrane protein may play a role in tumor angiogenesis through its interaction with the human homolog of the Drosophila disc large tumor suppressor gene. This gene is mapped to a candidate region of chromosome 4 which may be associated with bipolar disorder and schizophrenia.
Product Categories/Family for anti-ADGRA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa/68kDa/131kDa/146kDa
NCBI Official Full Name
adhesion G protein-coupled receptor A3
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor A3
NCBI Official Symbol
ADGRA3
NCBI Official Synonym Symbols
PGR21; TEM5L; GPR125
NCBI Protein Information
adhesion G protein-coupled receptor A3
UniProt Protein Name
Adhesion G protein-coupled receptor A3
UniProt Gene Name
ADGRA3

NCBI Description

This gene encodes a member of the G protein-coupled receptor superfamily. This membrane protein may play a role in tumor angiogenesis through its interaction with the human homolog of the Drosophila disc large tumor suppressor gene. This gene is mapped to a candidate region of chromosome 4 which may be associated with bipolar disorder and schizophrenia. [provided by RefSeq, Oct 2012]

Uniprot Description

Orphan receptor that may have a role in planar cell polarity pathway.

Research Articles on ADGRA3

Similar Products

Product Notes

The ADGRA3 adgra3 (Catalog #AAA9135559) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADGRA3 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADGRA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the ADGRA3 adgra3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ITAYLQCTRN THGSGIYPGN PQDERKAWRR CDRGGFWADD DYSRCQYAND VTRVLYMFNQ MPLNLTNAVA TARQLLAYTV EAANFSDKMD VIFVAEMIEK FGRFTKEEKS KELGDVMVDI ASNIMLADER VLWLAQREAK ACSRIVQCLQ RIATYRLAGG AHVYSTYSPN IALEAYVIKS TGFTGMTCTV FQKVAASDRT GLSDYGRRDP EGNLDKQLSF KCNVSNTFSS L. It is sometimes possible for the material contained within the vial of "ADGRA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.