Rabbit anti-Human, Rat SYNJ2BP Polyclonal Antibody | anti-SYNJ2BP antibody
SYNJ2BP Polyclonal Antibody
Gene Names
SYNJ2BP; ARIP2; OMP25
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SYNJ2BP; Polyclonal Antibody; SYNJ2BP Polyclonal Antibody; ARIP2; OMP25; anti-SYNJ2BP antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMRYRQQL
Sequence Length
145
Applicable Applications for anti-SYNJ2BP antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human SYNJ2BP
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion outer membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-SYNJ2BP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15kDa
NCBI Official Full Name
synaptojanin-2-binding protein
NCBI Official Synonym Full Names
synaptojanin 2 binding protein
NCBI Official Symbol
SYNJ2BP
NCBI Official Synonym Symbols
ARIP2; OMP25
NCBI Protein Information
synaptojanin-2-binding protein
UniProt Protein Name
Synaptojanin-2-binding protein
Protein Family
UniProt Gene Name
SYNJ2BP
UniProt Synonym Gene Names
OMP25
Uniprot Description
Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.
Research Articles on SYNJ2BP
Similar Products
Product Notes
The SYNJ2BP synj2bp (Catalog #AAA9135455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYNJ2BP Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYNJ2BP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the SYNJ2BP synj2bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNGRVDYLVT EEEINLTRGP SGLGFNIVGG TDQQYVSNDS GIYVSRIKEN GAAALDGRLQ EGDKILSVNG QDLKNLLHQD AVDLFRNAGY AVSLRVQHRL QVQNGPIGHR GEGDPSGIPI FMVLVPVFAL TMVAAWAFMR YRQQL. It is sometimes possible for the material contained within the vial of "SYNJ2BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
