Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Rat REC8 Polyclonal Antibody | anti-REC8 antibody

REC8 Polyclonal Antibody

Gene Names
Rec8; mrec; Rec8L1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
REC8; Polyclonal Antibody; REC8 Polyclonal Antibody; HR21spB; REC8L1; Rec8p; anti-REC8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EVITLQEAEPIRMLQIEGEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDESREEPRALEGAGLVSALSPPAPAQVEGIQEALPGQVFPPEVQKMTGWEPGALLTEVTPPQELRLPAPPSTEKRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEYPVAQPPKRMLTSPAELFRTPTLSGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALS
Sequence Length
393
Applicable Applications for anti-REC8 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of mouse REC8
Immunogen Species
Mouse
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Chromosome, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-REC8 antibody
This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene.
Product Categories/Family for anti-REC8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
67kDa
NCBI Official Full Name
rec8
NCBI Official Synonym Full Names
REC8 meiotic recombination protein
NCBI Official Symbol
Rec8
NCBI Official Synonym Symbols
mrec; Rec8L1
NCBI Protein Information
meiotic recombination protein REC8 homolog
UniProt Protein Name
Meiotic recombination protein REC8 homolog
UniProt Gene Name
Rec8
UniProt Synonym Gene Names
Mei8; Rec8L1

Uniprot Description

Required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II.

Research Articles on REC8

Similar Products

Product Notes

The REC8 rec8 (Catalog #AAA9134991) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REC8 Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's REC8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the REC8 rec8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EVITLQEAEP IRMLQIEGEQ DLPEISRGDL ELLIAEKDDA ILLEERQRGR LLRQRRASLP LDESREEPRA LEGAGLVSAL SPPAPAQVEG IQEALPGQVF PPEVQKMTGW EPGALLTEVT PPQELRLPAP PSTEKRLPSL QRPLPRRHRR RQLLFWDKET QISREKFEEQ LQTGAHCWEY PVAQPPKRML TSPAELFRTP TLSGWLPPEL LGLWTHCAQV PQRMLRQRPQ LETEETVEEE RAADEEERRK TEALS. It is sometimes possible for the material contained within the vial of "REC8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.