Rabbit anti-Human, Mouse XBP1 Polyclonal Antibody | anti-XBP1 antibody

XBP1 Polyclonal Antibody

Cat. Num. AAA9134649

• Gene Names: XBP1; XBP2; TREB5; XBP-1; TREB-5
• Reactivity: Human, Mouse
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purification
• Synonyms: XBP1; Polyclonal Antibody; XBP1 Polyclonal Antibody; TREB-5; TREB5; XBP-1; XBP2; anti-XBP1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPS
• Sequence Length: 376

• Applicable Applications for anti-XBP1 antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; IF: 1:50 - 1:200
• Immunogen: Recombinant protein of human XBP1
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cytoplasm, Endoplasmic reticulum membrane, Endoplasmic reticulum, Membrane, Nucleus, Peripheral membrane protein, Single-pass type II membrane protein
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human uterus using XBP1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human uterine cancer using XBP1 antibody at dilution of 1:100 (40x lens).)

Related Product Information for anti-XBP1 antibody

This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5.

Product Categories/Family for anti-XBP1 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 118640873
• NCBI GeneID: 7494
• NCBI Accession #: NP_001073007.1
• NCBI GenBank Nucleotide #: NM_001079539.1
• UniProt Accession #: P17861; Q8WYK6; Q969P1; Q96BD7
• Molecular Weight: 28kDa/40kDa
• NCBI Official Full Name: X-box-binding protein 1 isoform XBP1(S)
• NCBI Official Synonym Full Names: X-box binding protein 1
• NCBI Official Symbol: XBP1
• NCBI Official Synonym Symbols: XBP2; TREB5; XBP-1; TREB-5
• NCBI Protein Information: X-box-binding protein 1
• UniProt Protein Name: X-box-binding protein 1
• Protein Family: X-box-binding protein
• UniProt Gene Name: XBP1
• UniProt Synonym Gene Names: TREB-5

NCBI Description

This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5. [provided by RefSeq, Jul 2008]

Uniprot Description

Functions as a transcription factor during endoplasmic reticulum (ER) stress by regulating the unfolded protein response (UPR). Required for cardiac myogenesis and hepatogenesis during embryonic development, and the development of secretory tissues such as exocrine pancreas and salivary gland (). Involved in terminal differentiation of B lymphocytes to plasma cells and production of immunoglobulins (PubMed:11460154). Modulates the cellular response to ER stress in a PIK3R-dependent manner (PubMed:20348923). Binds to the cis-acting X box present in the promoter regions of major histocompatibility complex class II genes (PubMed:8349596). Involved in VEGF-induced endothelial cell (EC) proliferation and retinal blood vessel formation during embryonic development but also for angiogenesis in adult tissues under ischemic conditions. Functions also as a major regulator of the UPR in obesity-induced insulin resistance and type 2 diabetes for the management of obesity and diabetes prevention ().