Rabbit anti-Rat CALM3 Polyclonal Antibody | anti-CALM3 antibody

CALM3 Polyclonal Antibody

Cat. Num. AAA9134529

• Gene Names: CALM1; caM; CAMI; PHKD; CPVT4; DD132; LQT14; CALML2
• Reactivity: Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: CALM3; Polyclonal Antibody; CALM3 Polyclonal Antibody; HEL-S-72; PHKD; PHKD3; anti-CALM3 antibody

• Host: Rabbit
• Reactivity: Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGY

• Applicable Applications for anti-CALM3 antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: A synthetic peptide of human CALM3
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cytoplasm, cytoskeleton, spindle, spindle pole
• Positive Samples: Rat testis
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of rat testis, using CALM3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.)

Product Categories/Family for anti-CALM3 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 49037474
• NCBI GeneID: 801
• UniProt Accession #: P62158; P0DP23
• Molecular Weight: Calculated: 16kDa; Observed: 17kDa
• NCBI Official Synonym Full Names: calmodulin 1
• NCBI Official Symbol: CALM1
• NCBI Official Synonym Symbols: caM; CAMI; PHKD; CPVT4; DD132; LQT14; CALML2
• NCBI Protein Information: calmodulin-1; calmodulin

NCBI Description

This gene encodes a member of the EF-hand calcium-binding protein family. It is one of three genes which encode an identical calcium binding protein which is one of the four subunits of phosphorylase kinase. Two pseudogenes have been identified on chromosome 7 and X. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]