Rabbit anti-Mouse, Rat ERBB3 Polyclonal Antibody | anti-ERBB3 antibody

ERBB3 Polyclonal Antibody

Cat. Num. AAA9133986

• Gene Names: ERBB3; HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
• Reactivity: Mouse, Rat
• Applications: Immunohistochemistry
• Purity: Affinity Purification
• Synonyms: ERBB3; Polyclonal Antibody; ERBB3 Polyclonal Antibody; c-erbB-3; c-erbB3; ErbB-3; erbB3-S; HER3; LCCS2; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3; anti-ERBB3 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEP
• Sequence Length: 183

• Applicable Applications for anti-ERBB3 antibody: Immunohistochemistry (IHC)
• Application Notes: IHC: 1:50 - 1:200
• Immunogen: Recombinant protein of human ERBB3
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cell membrane, Secreted, Single-pass type I membrane protein
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat brain using ERBB3 Antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse brain using ERBB3 Antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse kidney using ERBB3 Antibody at dilution of 1:100 (40x lens).)

Related Product Information for anti-ERBB3 antibody

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.

Product Categories/Family for anti-ERBB3 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 54792102
• NCBI GeneID: 2065
• NCBI Accession #: NP_001005915.1
• NCBI GenBank Nucleotide #: NM_001005915.1
• UniProt Accession #: P21860; Q9BUD7; A8K6L6; B4DIK7; B4DV32; E9PDT8
• Molecular Weight: 20kDa/36kDa/77kDa/141kDa/148kDa
• NCBI Official Full Name: receptor tyrosine-protein kinase erbB-3 isoform s
• NCBI Official Synonym Full Names: erb-b2 receptor tyrosine kinase 3
• NCBI Official Symbol: ERBB3
• NCBI Official Synonym Symbols: HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
• NCBI Protein Information: receptor tyrosine-protein kinase erbB-3
• UniProt Protein Name: Receptor tyrosine-protein kinase erbB-3
• Protein Family: Receptor tyrosine-protein kinase
• UniProt Gene Name: ERBB3
• UniProt Synonym Gene Names: HER3

NCBI Description

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase (PubMed:20682778). May also be activated by CSPG5 (PubMed:15358134).