Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using VSIG1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit anti-Human, Mouse VSIG1 Polyclonal Antibody | anti-VSIG1 antibody
VSIG1 Polyclonal Antibody
Gene Names
VSIG1; GPA34; dJ889N15.1; 1700062D20Rik
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
VSIG1; Polyclonal Antibody; VSIG1 Polyclonal Antibody; 1700062D20Rik; dJ889N15.1; GPA34; anti-VSIG1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSH
Sequence Length
423
Applicable Applications for anti-VSIG1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human VSIG1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type I membrane protein
Positive Samples
BxPC3, OVCAR3, Mouse testis, Mouse stomach, Mouse pancreas,
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using VSIG1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using VSIG1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-VSIG1 antibody
This gene encodes a member of the junctional adhesion molecule (JAM) family. The encoded protein contains multiple glycosylation sites at the N-terminal region, and multiple phosphorylation sites and glutamic acid/proline (EP) repeats at the C-terminal region. The gene is expressed in normal stomach and testis, as well as in gastric, esophageal and ovarian cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-VSIG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 41kDa; 45kDa
Observed: 65kDa
Observed: 65kDa
NCBI Official Full Name
V-set and immunoglobulin domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
V-set and immunoglobulin domain containing 1
NCBI Official Symbol
VSIG1
NCBI Official Synonym Symbols
GPA34; dJ889N15.1; 1700062D20Rik
NCBI Protein Information
V-set and immunoglobulin domain-containing protein 1
UniProt Protein Name
V-set and immunoglobulin domain-containing protein 1
Protein Family
UniProt Gene Name
VSIG1
UniProt Synonym Gene Names
GPA34
NCBI Description
This gene encodes a member of the junctional adhesion molecule (JAM) family. The encoded protein contains multiple glycosylation sites at the N-terminal region, and multiple phosphorylation sites and glutamic acid/proline (EP) repeats at the C-terminal region. The gene is expressed in normal stomach and testis, as well as in gastric, esophageal and ovarian cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
Research Articles on VSIG1
Similar Products
Product Notes
The VSIG1 vsig1 (Catalog #AAA9133889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VSIG1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's VSIG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the VSIG1 vsig1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASREQLSIQW SFFHKKEMEP ISIYFSQGGQ AVAIGQFKDR ITGSNDPGNA SITISHMQPA DSGIYICDVN NPPDFLGQNQ GILNVSVLVK PSKPLCSVQG RPETGHTISL SCLSALGTPS PVYYWHKLEG RDIVPVKENF NPTTGILVIG NLTNFEQGYY QCTAINRLGN SSCEIDLTSS H. It is sometimes possible for the material contained within the vial of "VSIG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
