Rabbit anti-Human NEU3 Polyclonal Antibody | anti-NEU3 antibody
NEU3 Polyclonal Antibody
Gene Names
NEU3; SIAL3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NEU3; Polyclonal Antibody; NEU3 Polyclonal Antibody; SIAL3; anti-NEU3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
CFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN
Sequence Length
461
Applicable Applications for anti-NEU3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human NEU3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Peripheral membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-NEU3 antibody
This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer.
Product Categories/Family for anti-NEU3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48kDa/51kDa
NCBI Official Full Name
sialidase-3
NCBI Official Synonym Full Names
neuraminidase 3
NCBI Official Symbol
NEU3
NCBI Official Synonym Symbols
SIAL3
NCBI Protein Information
sialidase-3
UniProt Protein Name
Sialidase-3
Protein Family
UniProt Gene Name
NEU3
NCBI Description
This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. [provided by RefSeq, Jul 2008]
Uniprot Description
Plays a role in modulating the ganglioside content of the lipid bilayer at the level of membrane-bound sialyl glycoconjugates.
Research Articles on NEU3
Similar Products
Product Notes
The NEU3 neu3 (Catalog #AAA9133858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEU3 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEU3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the NEU3 neu3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CFQLPCKTRP HSLMIYSDDL GVTWHHGRLI RPMVTVECEV AEVTGRAGHP VLYCSARTPN RCRAEALSTD HGEGFQRLAL SRQLCEPPHG CQGSVVSFRP LEIPHRCQDS SSKDAPTIQQ SSPGSSLRLE EEAGTPSESW LLYSHPTSRK QRVDLGIYLN QTPLEAACWS RPWILHCGPC GYSDLAALEE EGLFGCLFEC GTKQECEQIA FRLFTHREIL SHLQGDCTSP GRNPSQFKSN. It is sometimes possible for the material contained within the vial of "NEU3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
